Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TUK6

Protein Details
Accession A0A397TUK6    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-36ITSYEKYRNPDKPKHKLNEYRLVKHydrophilic
119-150YKNSWRFKWYENKKLKCKKFKITKNRTSEQAKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, mito_nucl 13.5, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001471  AP2/ERF_dom  
IPR044925  His-Me_finger_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00847  AP2  
Amino Acid Sequences MYWKNKFKNFEIITSYEKYRNPDKPKHKLNEYRLVKINFKLYLEIISKNYYTFYIKSTNNKYFHRMIYPEWKMIDHINRNGLDNRDENLQKTTPRENALNCKLSKNNTSRYNGIYFNKYKNSWRFKWYENKKLKCKKFKITKNRTSEQAKQLAIDFKLKHDKITQNMNRSLVLYT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.46
3 0.41
4 0.41
5 0.4
6 0.43
7 0.49
8 0.53
9 0.59
10 0.66
11 0.71
12 0.79
13 0.83
14 0.84
15 0.85
16 0.84
17 0.85
18 0.8
19 0.76
20 0.74
21 0.69
22 0.62
23 0.55
24 0.52
25 0.43
26 0.38
27 0.33
28 0.25
29 0.26
30 0.25
31 0.25
32 0.21
33 0.21
34 0.21
35 0.19
36 0.19
37 0.16
38 0.16
39 0.15
40 0.16
41 0.2
42 0.23
43 0.3
44 0.37
45 0.44
46 0.46
47 0.48
48 0.5
49 0.47
50 0.46
51 0.43
52 0.37
53 0.33
54 0.38
55 0.38
56 0.35
57 0.32
58 0.3
59 0.27
60 0.28
61 0.31
62 0.26
63 0.25
64 0.27
65 0.27
66 0.29
67 0.3
68 0.28
69 0.24
70 0.2
71 0.19
72 0.19
73 0.19
74 0.18
75 0.19
76 0.19
77 0.18
78 0.2
79 0.23
80 0.21
81 0.23
82 0.25
83 0.25
84 0.32
85 0.36
86 0.38
87 0.35
88 0.36
89 0.36
90 0.37
91 0.41
92 0.38
93 0.4
94 0.41
95 0.45
96 0.44
97 0.45
98 0.45
99 0.42
100 0.4
101 0.39
102 0.35
103 0.36
104 0.38
105 0.37
106 0.42
107 0.46
108 0.52
109 0.49
110 0.52
111 0.52
112 0.53
113 0.62
114 0.64
115 0.65
116 0.67
117 0.72
118 0.77
119 0.83
120 0.87
121 0.87
122 0.86
123 0.86
124 0.86
125 0.88
126 0.89
127 0.89
128 0.89
129 0.87
130 0.83
131 0.81
132 0.77
133 0.75
134 0.72
135 0.69
136 0.59
137 0.52
138 0.5
139 0.48
140 0.42
141 0.4
142 0.33
143 0.32
144 0.42
145 0.41
146 0.41
147 0.43
148 0.48
149 0.47
150 0.58
151 0.59
152 0.57
153 0.62
154 0.61
155 0.54