Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TTA1

Protein Details
Accession A0A397TTA1    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
7-39WDYMRHNNKEFRNKWKRGKKKAAKRRRAEVEVABasic
NLS Segment(s)
PositionSequence
17-34FRNKWKRGKKKAAKRRRA
Subcellular Location(s) nucl 15.5, cyto_nucl 13, cyto 7.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002056  MAS20  
IPR023392  Tom20_dom_sf  
Gene Ontology GO:0005742  C:mitochondrial outer membrane translocase complex  
GO:0006605  P:protein targeting  
Pfam View protein in Pfam  
PF02064  MAS20  
Amino Acid Sequences IGYIVYWDYMRHNNKEFRNKWKRGKKKAAKRRRAEVEVAKDRITTFVKKAVDEVSKESFPTDVAAKEKYFMDQVSNGETLLAEGKERHLDAALCFYKALKVYPNPVELIMIYQKTIPEAVINVIYEMMSFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.65
3 0.66
4 0.68
5 0.73
6 0.77
7 0.81
8 0.84
9 0.86
10 0.86
11 0.92
12 0.92
13 0.92
14 0.94
15 0.94
16 0.94
17 0.91
18 0.9
19 0.88
20 0.82
21 0.78
22 0.75
23 0.74
24 0.72
25 0.66
26 0.56
27 0.47
28 0.42
29 0.38
30 0.33
31 0.25
32 0.19
33 0.22
34 0.23
35 0.23
36 0.24
37 0.25
38 0.24
39 0.23
40 0.25
41 0.23
42 0.22
43 0.22
44 0.21
45 0.16
46 0.13
47 0.13
48 0.1
49 0.08
50 0.1
51 0.11
52 0.11
53 0.12
54 0.12
55 0.12
56 0.11
57 0.1
58 0.1
59 0.11
60 0.11
61 0.13
62 0.13
63 0.12
64 0.11
65 0.11
66 0.09
67 0.09
68 0.08
69 0.06
70 0.06
71 0.07
72 0.09
73 0.09
74 0.09
75 0.09
76 0.1
77 0.1
78 0.18
79 0.18
80 0.17
81 0.17
82 0.16
83 0.18
84 0.18
85 0.19
86 0.16
87 0.18
88 0.24
89 0.28
90 0.3
91 0.29
92 0.28
93 0.28
94 0.22
95 0.22
96 0.2
97 0.17
98 0.15
99 0.15
100 0.15
101 0.15
102 0.16
103 0.12
104 0.09
105 0.1
106 0.12
107 0.13
108 0.13
109 0.12
110 0.12
111 0.12