Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397WDH5

Protein Details
Accession A0A397WDH5    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MSKGYYFWKKSQYKRFLKQKQQQEKQQLYQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 8, cyto 2
Family & Domain DBs
Amino Acid Sequences MSKGYYFWKKSQYKRFLKQKQQQEKQQLYQQWNGIVKHKITRHIPLPPIRYPDQVPDLTKKDQAEPNKNWSSETRLDPPNSEVKPNGRIRLRQSFFNVVRLETPKEMYQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.88
3 0.88
4 0.9
5 0.9
6 0.9
7 0.9
8 0.89
9 0.88
10 0.88
11 0.84
12 0.79
13 0.77
14 0.72
15 0.65
16 0.61
17 0.53
18 0.47
19 0.45
20 0.4
21 0.38
22 0.35
23 0.31
24 0.33
25 0.34
26 0.35
27 0.34
28 0.37
29 0.37
30 0.39
31 0.44
32 0.43
33 0.46
34 0.43
35 0.45
36 0.42
37 0.4
38 0.35
39 0.32
40 0.3
41 0.27
42 0.26
43 0.25
44 0.27
45 0.26
46 0.28
47 0.26
48 0.26
49 0.29
50 0.35
51 0.4
52 0.39
53 0.46
54 0.48
55 0.48
56 0.45
57 0.41
58 0.4
59 0.36
60 0.37
61 0.35
62 0.35
63 0.36
64 0.36
65 0.37
66 0.39
67 0.35
68 0.33
69 0.3
70 0.29
71 0.37
72 0.4
73 0.45
74 0.42
75 0.46
76 0.51
77 0.59
78 0.58
79 0.55
80 0.56
81 0.58
82 0.54
83 0.56
84 0.5
85 0.4
86 0.43
87 0.41
88 0.4
89 0.32
90 0.34