Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UB84

Protein Details
Accession A0A397UB84    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-38MVRRKEKEKEARNQRIKEQERTRRERKWNVNEQKKLTGBasic
NLS Segment(s)
PositionSequence
3-43RRKEKEKEARNQRIKEQERTRRERKWNVNEQKKLTGRITKK
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MVRRKEKEKEARNQRIKEQERTRRERKWNVNEQKKLTGRITKKREEFTEEFTEKRQRRNITPSPQKNDKNDKEEPTKELAEKLLRNGKEYPREMMKNYYKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.82
3 0.78
4 0.78
5 0.77
6 0.76
7 0.77
8 0.81
9 0.81
10 0.8
11 0.83
12 0.83
13 0.83
14 0.83
15 0.84
16 0.86
17 0.88
18 0.86
19 0.8
20 0.79
21 0.71
22 0.65
23 0.58
24 0.56
25 0.53
26 0.56
27 0.58
28 0.57
29 0.59
30 0.58
31 0.56
32 0.56
33 0.5
34 0.46
35 0.48
36 0.41
37 0.37
38 0.36
39 0.43
40 0.36
41 0.4
42 0.4
43 0.36
44 0.4
45 0.48
46 0.54
47 0.56
48 0.65
49 0.68
50 0.69
51 0.74
52 0.75
53 0.74
54 0.76
55 0.72
56 0.68
57 0.66
58 0.65
59 0.64
60 0.61
61 0.56
62 0.51
63 0.47
64 0.41
65 0.36
66 0.34
67 0.32
68 0.3
69 0.34
70 0.37
71 0.35
72 0.37
73 0.42
74 0.45
75 0.48
76 0.49
77 0.49
78 0.5
79 0.53
80 0.53
81 0.57