Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397W0G6

Protein Details
Accession A0A397W0G6    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
17-45ILKGVSQKGDLKKKRRKKEVDQGARDSKABasic
NLS Segment(s)
PositionSequence
25-41GDLKKKRRKKEVDQGAR
53-58EKEKGK
Subcellular Location(s) nucl 21.5, cyto_nucl 13.333, mito_nucl 12.666, cyto 3
Family & Domain DBs
Amino Acid Sequences MGSGDDSTNTKRLGTFILKGVSQKGDLKKKRRKKEVDQGARDSKATNMGSKQEKEKGKLEDMKKVVKRNQPNLSFRLPKYTKGSIKTFETRKTTSAGLAEFCLNHNEKAYTTSMYCKTQKELVKKVKSNERSTDSKKIEIEISKEGNYEEEKRIESESATAGATAGTAAGAAASAAASAAGHNIYLSKEEKVLVEMYNLEKMIQEQQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.28
4 0.3
5 0.31
6 0.31
7 0.33
8 0.29
9 0.27
10 0.31
11 0.35
12 0.43
13 0.51
14 0.6
15 0.68
16 0.76
17 0.84
18 0.88
19 0.88
20 0.88
21 0.9
22 0.91
23 0.91
24 0.89
25 0.86
26 0.82
27 0.74
28 0.64
29 0.53
30 0.43
31 0.39
32 0.33
33 0.28
34 0.23
35 0.28
36 0.34
37 0.36
38 0.4
39 0.4
40 0.44
41 0.45
42 0.48
43 0.46
44 0.48
45 0.53
46 0.51
47 0.52
48 0.51
49 0.56
50 0.54
51 0.57
52 0.57
53 0.57
54 0.63
55 0.64
56 0.69
57 0.68
58 0.68
59 0.65
60 0.65
61 0.62
62 0.54
63 0.55
64 0.47
65 0.43
66 0.45
67 0.48
68 0.46
69 0.45
70 0.48
71 0.41
72 0.45
73 0.48
74 0.45
75 0.44
76 0.44
77 0.41
78 0.38
79 0.37
80 0.32
81 0.26
82 0.23
83 0.18
84 0.13
85 0.13
86 0.12
87 0.1
88 0.1
89 0.11
90 0.11
91 0.1
92 0.11
93 0.1
94 0.1
95 0.12
96 0.13
97 0.11
98 0.11
99 0.15
100 0.17
101 0.21
102 0.24
103 0.23
104 0.24
105 0.29
106 0.34
107 0.37
108 0.44
109 0.5
110 0.55
111 0.58
112 0.62
113 0.65
114 0.67
115 0.65
116 0.62
117 0.58
118 0.56
119 0.58
120 0.62
121 0.55
122 0.52
123 0.47
124 0.42
125 0.41
126 0.36
127 0.33
128 0.28
129 0.28
130 0.25
131 0.25
132 0.23
133 0.21
134 0.21
135 0.22
136 0.2
137 0.19
138 0.2
139 0.21
140 0.22
141 0.21
142 0.18
143 0.16
144 0.14
145 0.13
146 0.12
147 0.1
148 0.09
149 0.08
150 0.07
151 0.05
152 0.04
153 0.03
154 0.03
155 0.02
156 0.02
157 0.02
158 0.02
159 0.02
160 0.02
161 0.02
162 0.02
163 0.02
164 0.03
165 0.03
166 0.04
167 0.04
168 0.04
169 0.04
170 0.06
171 0.06
172 0.1
173 0.12
174 0.12
175 0.13
176 0.15
177 0.15
178 0.17
179 0.18
180 0.15
181 0.15
182 0.17
183 0.18
184 0.2
185 0.2
186 0.18
187 0.17
188 0.18