Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397V0W4

Protein Details
Accession A0A397V0W4    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
39-63KEVVQGKKDEKKVKNTNKNEKADEKBasic
73-99KEVKAKEVKAEKNKKHNEKNKKQAEFEBasic
172-194DKYNEQHDKKKENKNHVKAKKTDBasic
203-263NEKHEAKKLKAKEHKVKVDETKHKKVHKNEKVHEKQSKHQKVKGVKKVHEDEKHHKKQNKHBasic
NLS Segment(s)
PositionSequence
44-94GKKDEKKVKNTNKNEKADEKTKKHAEAKDKEVKAKEVKAEKNKKHNEKNKK
180-263KKKENKNHVKAKKTDEHEKSDEHNEKHEAKKLKAKEHKVKVDETKHKKVHKNEKVHEKQSKHQKVKGVKKVHEDEKHHKKQNKH
Subcellular Location(s) extr 10, E.R. 6, nucl 3, vacu 3, mito 2, golg 2
Family & Domain DBs
Amino Acid Sequences MKFNIATVSLILLAASTFAAPVPSDNTKDLVLEKRAHSKEVVQGKKDEKKVKNTNKNEKADEKTKKHAEAKDKEVKAKEVKAEKNKKHNEKNKKQAEFEANHDKTKQKHDEINKSHKDLDLQHDEKNTKHGKNKEKHAEIKNKDGSQAKYHEKEQSYGSSHEGHTKLHLKEDKYNEQHDKKKENKNHVKAKKTDEHEKSDEHNEKHEAKKLKAKEHKVKVDETKHKKVHKNEKVHEKQSKHQKVKGVKKVHEDEKHHKKQNKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.04
4 0.04
5 0.04
6 0.05
7 0.05
8 0.07
9 0.12
10 0.15
11 0.18
12 0.2
13 0.22
14 0.21
15 0.22
16 0.25
17 0.27
18 0.28
19 0.3
20 0.32
21 0.41
22 0.42
23 0.42
24 0.4
25 0.37
26 0.4
27 0.46
28 0.49
29 0.42
30 0.47
31 0.53
32 0.6
33 0.64
34 0.66
35 0.62
36 0.66
37 0.74
38 0.79
39 0.82
40 0.84
41 0.87
42 0.87
43 0.87
44 0.83
45 0.79
46 0.75
47 0.74
48 0.73
49 0.67
50 0.67
51 0.66
52 0.67
53 0.67
54 0.67
55 0.67
56 0.64
57 0.68
58 0.68
59 0.65
60 0.64
61 0.59
62 0.58
63 0.53
64 0.5
65 0.48
66 0.46
67 0.52
68 0.57
69 0.65
70 0.66
71 0.72
72 0.78
73 0.81
74 0.83
75 0.85
76 0.85
77 0.85
78 0.89
79 0.88
80 0.83
81 0.75
82 0.71
83 0.7
84 0.61
85 0.56
86 0.57
87 0.48
88 0.45
89 0.44
90 0.4
91 0.36
92 0.42
93 0.42
94 0.35
95 0.4
96 0.47
97 0.56
98 0.6
99 0.68
100 0.63
101 0.59
102 0.56
103 0.5
104 0.44
105 0.36
106 0.35
107 0.33
108 0.31
109 0.3
110 0.33
111 0.33
112 0.31
113 0.36
114 0.35
115 0.29
116 0.35
117 0.41
118 0.47
119 0.53
120 0.62
121 0.64
122 0.65
123 0.69
124 0.7
125 0.72
126 0.66
127 0.68
128 0.64
129 0.55
130 0.53
131 0.49
132 0.43
133 0.38
134 0.41
135 0.38
136 0.35
137 0.37
138 0.39
139 0.35
140 0.35
141 0.32
142 0.31
143 0.28
144 0.27
145 0.26
146 0.23
147 0.22
148 0.27
149 0.25
150 0.21
151 0.22
152 0.28
153 0.26
154 0.31
155 0.35
156 0.32
157 0.39
158 0.46
159 0.5
160 0.48
161 0.54
162 0.55
163 0.59
164 0.63
165 0.63
166 0.65
167 0.64
168 0.71
169 0.72
170 0.75
171 0.78
172 0.8
173 0.84
174 0.84
175 0.84
176 0.79
177 0.8
178 0.77
179 0.72
180 0.73
181 0.68
182 0.67
183 0.61
184 0.58
185 0.54
186 0.55
187 0.57
188 0.47
189 0.46
190 0.44
191 0.46
192 0.48
193 0.51
194 0.47
195 0.44
196 0.52
197 0.54
198 0.59
199 0.63
200 0.7
201 0.73
202 0.77
203 0.82
204 0.77
205 0.78
206 0.76
207 0.77
208 0.78
209 0.76
210 0.76
211 0.75
212 0.8
213 0.81
214 0.82
215 0.83
216 0.82
217 0.84
218 0.83
219 0.86
220 0.87
221 0.88
222 0.87
223 0.81
224 0.8
225 0.81
226 0.83
227 0.79
228 0.74
229 0.73
230 0.75
231 0.8
232 0.81
233 0.8
234 0.75
235 0.77
236 0.81
237 0.82
238 0.81
239 0.79
240 0.8
241 0.81
242 0.85
243 0.85