Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UPN3

Protein Details
Accession A0A397UPN3    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
10-30FSIPSKKKLSTRYKDKVEANFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto_nucl 4, nucl 3.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003165  Piwi  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF02171  Piwi  
PROSITE View protein in PROSITE  
PS50822  PIWI  
Amino Acid Sequences MPKNVLTLPFSIPSKKKLSTRYKDKVEANFAINSPQHMVFTADVYYSSKEDKKKGQPSVSAVCGSMNDNLTEFSCRYRINEKLRHDVDIIENLNKMVLELFKQHKVKGNLLPEIIFYRDGIGETQFETVKTDKLEPLLVALEKYYKFEKLPPPKLTFMIIQKRHHARFKLLNGKNCKHGIVVDTEIVISQEFSFYLQSHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.45
3 0.48
4 0.53
5 0.62
6 0.66
7 0.74
8 0.77
9 0.79
10 0.81
11 0.81
12 0.78
13 0.74
14 0.67
15 0.59
16 0.52
17 0.44
18 0.41
19 0.35
20 0.29
21 0.24
22 0.21
23 0.18
24 0.16
25 0.18
26 0.14
27 0.14
28 0.13
29 0.1
30 0.11
31 0.12
32 0.13
33 0.12
34 0.15
35 0.19
36 0.23
37 0.27
38 0.35
39 0.44
40 0.51
41 0.58
42 0.59
43 0.59
44 0.61
45 0.61
46 0.55
47 0.46
48 0.37
49 0.29
50 0.25
51 0.21
52 0.18
53 0.13
54 0.11
55 0.1
56 0.11
57 0.11
58 0.12
59 0.11
60 0.1
61 0.13
62 0.13
63 0.16
64 0.2
65 0.27
66 0.34
67 0.42
68 0.45
69 0.51
70 0.52
71 0.51
72 0.46
73 0.4
74 0.32
75 0.29
76 0.26
77 0.17
78 0.16
79 0.14
80 0.14
81 0.12
82 0.1
83 0.06
84 0.05
85 0.05
86 0.09
87 0.12
88 0.18
89 0.2
90 0.21
91 0.27
92 0.3
93 0.34
94 0.35
95 0.37
96 0.32
97 0.32
98 0.31
99 0.25
100 0.23
101 0.19
102 0.14
103 0.1
104 0.08
105 0.08
106 0.08
107 0.08
108 0.08
109 0.07
110 0.08
111 0.09
112 0.09
113 0.09
114 0.1
115 0.11
116 0.12
117 0.13
118 0.14
119 0.13
120 0.14
121 0.15
122 0.13
123 0.13
124 0.13
125 0.12
126 0.1
127 0.1
128 0.12
129 0.11
130 0.14
131 0.14
132 0.14
133 0.15
134 0.21
135 0.31
136 0.39
137 0.48
138 0.52
139 0.56
140 0.57
141 0.57
142 0.53
143 0.48
144 0.47
145 0.48
146 0.48
147 0.47
148 0.53
149 0.6
150 0.64
151 0.67
152 0.61
153 0.58
154 0.6
155 0.67
156 0.69
157 0.67
158 0.69
159 0.71
160 0.71
161 0.71
162 0.63
163 0.54
164 0.45
165 0.4
166 0.34
167 0.3
168 0.29
169 0.23
170 0.21
171 0.2
172 0.19
173 0.17
174 0.15
175 0.1
176 0.07
177 0.07
178 0.07
179 0.08
180 0.1