Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397VK30

Protein Details
Accession A0A397VK30    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
102-134ITKDVKVPKKPAERRRKRTRVRRDLSNKRKEKVBasic
NLS Segment(s)
PositionSequence
107-142KVPKKPAERRRKRTRVRRDLSNKRKEKVGLGKLEKP
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MPVRNWSKSDEHKEVGVKIDESKENGVGKDNPSAKGTSNDNDDRDDSHKKEIGVEKDENKASVYNQKLTEIRSFEETRSYYKRGIGIEAEKNEDDATPIEAITKDVKVPKKPAERRRKRTRVRRDLSNKRKEKVGLGKLEKPRCKMMSLTKRIALYLPKWSKTQVYDTEERQTKLPLVETLKKVWSKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.49
3 0.42
4 0.34
5 0.3
6 0.33
7 0.31
8 0.3
9 0.3
10 0.29
11 0.28
12 0.27
13 0.29
14 0.27
15 0.27
16 0.32
17 0.33
18 0.31
19 0.31
20 0.31
21 0.28
22 0.29
23 0.31
24 0.26
25 0.31
26 0.33
27 0.33
28 0.34
29 0.33
30 0.32
31 0.33
32 0.36
33 0.31
34 0.33
35 0.34
36 0.31
37 0.37
38 0.4
39 0.41
40 0.39
41 0.42
42 0.39
43 0.41
44 0.42
45 0.36
46 0.3
47 0.25
48 0.21
49 0.25
50 0.25
51 0.24
52 0.25
53 0.27
54 0.28
55 0.29
56 0.32
57 0.26
58 0.24
59 0.25
60 0.25
61 0.22
62 0.26
63 0.24
64 0.25
65 0.28
66 0.29
67 0.25
68 0.26
69 0.29
70 0.24
71 0.24
72 0.22
73 0.22
74 0.24
75 0.23
76 0.24
77 0.2
78 0.2
79 0.19
80 0.16
81 0.12
82 0.08
83 0.08
84 0.06
85 0.06
86 0.07
87 0.07
88 0.08
89 0.08
90 0.08
91 0.09
92 0.14
93 0.18
94 0.21
95 0.26
96 0.33
97 0.43
98 0.52
99 0.61
100 0.67
101 0.74
102 0.81
103 0.88
104 0.9
105 0.9
106 0.92
107 0.93
108 0.93
109 0.88
110 0.88
111 0.87
112 0.88
113 0.88
114 0.88
115 0.83
116 0.74
117 0.73
118 0.63
119 0.61
120 0.59
121 0.57
122 0.55
123 0.55
124 0.61
125 0.65
126 0.72
127 0.69
128 0.62
129 0.62
130 0.54
131 0.5
132 0.48
133 0.5
134 0.52
135 0.55
136 0.56
137 0.53
138 0.52
139 0.5
140 0.47
141 0.41
142 0.33
143 0.36
144 0.38
145 0.37
146 0.37
147 0.39
148 0.41
149 0.4
150 0.44
151 0.42
152 0.42
153 0.46
154 0.48
155 0.55
156 0.56
157 0.54
158 0.47
159 0.42
160 0.37
161 0.34
162 0.34
163 0.3
164 0.32
165 0.39
166 0.41
167 0.43
168 0.47