Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397V642

Protein Details
Accession A0A397V642    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
18-37AFLRELRKRVRGPNKIEPLKHydrophilic
140-160KSSCVKKSKKFKESQMKSEKPHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12.5, cyto 11.5, nucl 10.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Pfam View protein in Pfam  
PF00505  HMG_box  
Amino Acid Sequences MIFIFEENPSAPNEKDNAFLRELRKRVRGPNKIEPLKSLPFPPKFDEHIFLRNKPNMGFKTKAANGWFFYRKAYVEELKANGRTYPMTEISKHIAELWKNEPERVRKYYKELASKAADLHHQAYGNDLSNNNNNNNNNNKSSCVKKSKKFKESQMKSEKPTTIPIEPKGLSTKLPFNEHSINITDEHIYSPYLPTTPCLEYNPYDLFYEPQCNNFYTEHVNLLGDNDNDNFNFDNEYFFWQQNLNTMNTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.26
3 0.29
4 0.31
5 0.31
6 0.35
7 0.38
8 0.44
9 0.5
10 0.51
11 0.55
12 0.57
13 0.64
14 0.7
15 0.73
16 0.72
17 0.77
18 0.81
19 0.8
20 0.75
21 0.7
22 0.66
23 0.61
24 0.54
25 0.5
26 0.48
27 0.46
28 0.48
29 0.47
30 0.46
31 0.46
32 0.47
33 0.46
34 0.4
35 0.44
36 0.45
37 0.45
38 0.48
39 0.47
40 0.45
41 0.42
42 0.47
43 0.43
44 0.44
45 0.42
46 0.36
47 0.42
48 0.42
49 0.44
50 0.38
51 0.37
52 0.33
53 0.37
54 0.38
55 0.29
56 0.29
57 0.27
58 0.25
59 0.24
60 0.27
61 0.23
62 0.23
63 0.26
64 0.27
65 0.29
66 0.3
67 0.28
68 0.23
69 0.21
70 0.19
71 0.17
72 0.18
73 0.18
74 0.18
75 0.19
76 0.21
77 0.23
78 0.23
79 0.22
80 0.19
81 0.2
82 0.18
83 0.21
84 0.22
85 0.26
86 0.26
87 0.28
88 0.31
89 0.33
90 0.38
91 0.4
92 0.41
93 0.37
94 0.43
95 0.49
96 0.5
97 0.51
98 0.47
99 0.46
100 0.43
101 0.42
102 0.36
103 0.29
104 0.25
105 0.19
106 0.18
107 0.15
108 0.13
109 0.12
110 0.14
111 0.14
112 0.13
113 0.12
114 0.11
115 0.12
116 0.15
117 0.17
118 0.17
119 0.2
120 0.21
121 0.24
122 0.3
123 0.32
124 0.31
125 0.3
126 0.31
127 0.29
128 0.33
129 0.36
130 0.4
131 0.44
132 0.48
133 0.59
134 0.66
135 0.73
136 0.75
137 0.77
138 0.78
139 0.78
140 0.81
141 0.81
142 0.75
143 0.69
144 0.69
145 0.61
146 0.51
147 0.5
148 0.43
149 0.38
150 0.37
151 0.35
152 0.35
153 0.32
154 0.33
155 0.31
156 0.27
157 0.24
158 0.23
159 0.27
160 0.25
161 0.29
162 0.28
163 0.3
164 0.34
165 0.33
166 0.32
167 0.28
168 0.26
169 0.23
170 0.22
171 0.18
172 0.14
173 0.14
174 0.12
175 0.11
176 0.1
177 0.1
178 0.1
179 0.11
180 0.1
181 0.11
182 0.15
183 0.17
184 0.19
185 0.2
186 0.23
187 0.23
188 0.28
189 0.28
190 0.26
191 0.24
192 0.22
193 0.22
194 0.2
195 0.26
196 0.22
197 0.24
198 0.24
199 0.25
200 0.27
201 0.25
202 0.26
203 0.24
204 0.25
205 0.23
206 0.22
207 0.21
208 0.19
209 0.2
210 0.22
211 0.16
212 0.16
213 0.15
214 0.16
215 0.16
216 0.18
217 0.17
218 0.13
219 0.16
220 0.15
221 0.17
222 0.17
223 0.23
224 0.24
225 0.24
226 0.25
227 0.23
228 0.24
229 0.26
230 0.28