Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397UCK3

Protein Details
Accession A0A397UCK3    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
39-59IRDKERKHERLKQNQLEHERQBasic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 5.5, cyto_nucl 4.5, plas 4, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR031568  Pet117  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF15786  PET117  
Amino Acid Sequences MSRIAKVTLVSVIILSTGTIFGVHYLQKKEKEAMHAGIIRDKERKHERLKQNQLEHERQVMLRKEYEKIQPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.06
3 0.05
4 0.04
5 0.04
6 0.04
7 0.04
8 0.05
9 0.06
10 0.09
11 0.13
12 0.17
13 0.21
14 0.24
15 0.26
16 0.29
17 0.29
18 0.31
19 0.31
20 0.28
21 0.28
22 0.27
23 0.25
24 0.25
25 0.25
26 0.22
27 0.23
28 0.21
29 0.26
30 0.32
31 0.39
32 0.44
33 0.53
34 0.61
35 0.68
36 0.79
37 0.79
38 0.79
39 0.81
40 0.8
41 0.75
42 0.68
43 0.6
44 0.51
45 0.44
46 0.44
47 0.41
48 0.37
49 0.37
50 0.37
51 0.37
52 0.4