Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397W0P0

Protein Details
Accession A0A397W0P0    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MFGQKKKKPQYNYQYRTPTLHydrophilic
NLS Segment(s)
PositionSequence
82-89KKYIPKRK
Subcellular Location(s) nucl 20, mito 6
Family & Domain DBs
Amino Acid Sequences MFGQKKKKPQYNYQYRTPTLPKQPINNPPTIPYVRPPVNLHRSPQQIIIDRQVQHRLNLGYIPPNTAPQRPPTIPLKPPTLKKYIPKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.73
3 0.72
4 0.67
5 0.63
6 0.61
7 0.64
8 0.59
9 0.57
10 0.64
11 0.67
12 0.65
13 0.61
14 0.52
15 0.46
16 0.48
17 0.43
18 0.36
19 0.29
20 0.32
21 0.29
22 0.32
23 0.32
24 0.35
25 0.41
26 0.41
27 0.41
28 0.41
29 0.42
30 0.4
31 0.4
32 0.35
33 0.31
34 0.3
35 0.32
36 0.3
37 0.28
38 0.29
39 0.34
40 0.31
41 0.28
42 0.3
43 0.27
44 0.22
45 0.22
46 0.21
47 0.19
48 0.19
49 0.21
50 0.18
51 0.22
52 0.24
53 0.27
54 0.28
55 0.27
56 0.35
57 0.33
58 0.37
59 0.38
60 0.43
61 0.46
62 0.48
63 0.53
64 0.52
65 0.59
66 0.61
67 0.62
68 0.61
69 0.65