Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UTG8

Protein Details
Accession A0A397UTG8    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
86-113CGGKSLPKKRYKWSPSTNKKGKQFRTNNHydrophilic
NLS Segment(s)
PositionSequence
93-97KKRYK
Subcellular Location(s) nucl 17, cyto_nucl 12.5, cyto 6, mito 3
Family & Domain DBs
Amino Acid Sequences MGNIEINEDSSYTANKETGKPENRFTKDDPIYKLFQHVFVNDSWSCASPIEKPYYSAGIFPAVCFLCGNRDVTNPSKGEHPLCARCGGKSLPKKRYKWSPSTNKKGKQFRTNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.17
3 0.2
4 0.24
5 0.32
6 0.39
7 0.41
8 0.48
9 0.55
10 0.57
11 0.59
12 0.57
13 0.58
14 0.56
15 0.58
16 0.55
17 0.49
18 0.47
19 0.43
20 0.45
21 0.35
22 0.32
23 0.27
24 0.23
25 0.21
26 0.18
27 0.23
28 0.17
29 0.18
30 0.15
31 0.14
32 0.14
33 0.13
34 0.14
35 0.12
36 0.15
37 0.19
38 0.18
39 0.19
40 0.2
41 0.22
42 0.21
43 0.18
44 0.15
45 0.13
46 0.13
47 0.11
48 0.13
49 0.1
50 0.1
51 0.1
52 0.09
53 0.1
54 0.11
55 0.13
56 0.11
57 0.13
58 0.16
59 0.2
60 0.24
61 0.22
62 0.22
63 0.23
64 0.25
65 0.25
66 0.27
67 0.3
68 0.29
69 0.3
70 0.35
71 0.32
72 0.3
73 0.32
74 0.31
75 0.34
76 0.4
77 0.48
78 0.53
79 0.61
80 0.66
81 0.71
82 0.78
83 0.78
84 0.78
85 0.8
86 0.8
87 0.82
88 0.89
89 0.9
90 0.88
91 0.89
92 0.89
93 0.88