Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397U2W5

Protein Details
Accession A0A397U2W5    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
51-94ISLQNPKRRKAKGRPKSFKRIKRSEELKPAPSKRQNQCKNCGDYHydrophilic
NLS Segment(s)
PositionSequence
56-83PKRRKAKGRPKSFKRIKRSEELKPAPSK
Subcellular Location(s) nucl 24.5, cyto_nucl 16
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MLKKLQDLLTELQEDVLVDSSDNDDGETCSNDNDGSNDSDDDKENDQLVEISLQNPKRRKAKGRPKSFKRIKRSEELKPAPSKRQNQCKNCGDYGHYRPRCPKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.15
3 0.13
4 0.08
5 0.07
6 0.07
7 0.09
8 0.09
9 0.09
10 0.08
11 0.07
12 0.08
13 0.09
14 0.1
15 0.09
16 0.09
17 0.09
18 0.09
19 0.09
20 0.09
21 0.1
22 0.1
23 0.11
24 0.11
25 0.12
26 0.13
27 0.13
28 0.15
29 0.14
30 0.14
31 0.13
32 0.12
33 0.11
34 0.1
35 0.09
36 0.08
37 0.07
38 0.07
39 0.11
40 0.14
41 0.19
42 0.23
43 0.28
44 0.34
45 0.4
46 0.49
47 0.56
48 0.64
49 0.69
50 0.77
51 0.83
52 0.84
53 0.89
54 0.9
55 0.88
56 0.87
57 0.86
58 0.81
59 0.8
60 0.78
61 0.75
62 0.76
63 0.73
64 0.7
65 0.69
66 0.68
67 0.68
68 0.71
69 0.71
70 0.7
71 0.76
72 0.79
73 0.77
74 0.82
75 0.81
76 0.79
77 0.72
78 0.66
79 0.6
80 0.59
81 0.6
82 0.62
83 0.58
84 0.57