Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397VET4

Protein Details
Accession A0A397VET4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
4-23QDLFRRYRKIEPKKIWLLRGHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 11, mito 6, E.R. 6, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIFQDLFRRYRKIEPKKIWLLRGFTIILLMACLVSYFLILVIEIMAEAPTIIQTFASVDNLPVPVIHILLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.74
3 0.8
4 0.81
5 0.78
6 0.72
7 0.65
8 0.56
9 0.51
10 0.41
11 0.3
12 0.25
13 0.19
14 0.13
15 0.09
16 0.07
17 0.04
18 0.03
19 0.03
20 0.03
21 0.03
22 0.03
23 0.02
24 0.02
25 0.02
26 0.02
27 0.03
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.02
36 0.03
37 0.03
38 0.04
39 0.03
40 0.04
41 0.05
42 0.06
43 0.09
44 0.09
45 0.09
46 0.11
47 0.11
48 0.11
49 0.1
50 0.11
51 0.09