Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397V9M9

Protein Details
Accession A0A397V9M9    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
93-114VTQIENPKKLKHKGRLKLPKPAHydrophilic
NLS Segment(s)
PositionSequence
99-114PKKLKHKGRLKLPKPA
Subcellular Location(s) nucl 15, cyto_nucl 14, cyto 11
Family & Domain DBs
Amino Acid Sequences MKIFLKIDTSAMEFDLNEEINQVISICEPDTYRASIHNNIILKQEYAYGFGVAKSMLKFVLESGLVNEFVELITGFIENYTGIDTNKKMIVKVTQIENPKKLKHKGRLKLPKPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.13
4 0.1
5 0.1
6 0.1
7 0.09
8 0.09
9 0.08
10 0.06
11 0.05
12 0.07
13 0.06
14 0.07
15 0.07
16 0.1
17 0.12
18 0.13
19 0.13
20 0.16
21 0.2
22 0.22
23 0.23
24 0.25
25 0.24
26 0.24
27 0.26
28 0.24
29 0.2
30 0.16
31 0.18
32 0.13
33 0.15
34 0.14
35 0.12
36 0.11
37 0.1
38 0.1
39 0.08
40 0.09
41 0.06
42 0.06
43 0.06
44 0.05
45 0.06
46 0.05
47 0.07
48 0.06
49 0.06
50 0.07
51 0.08
52 0.08
53 0.08
54 0.07
55 0.05
56 0.05
57 0.05
58 0.04
59 0.03
60 0.03
61 0.04
62 0.04
63 0.03
64 0.04
65 0.03
66 0.04
67 0.05
68 0.06
69 0.06
70 0.09
71 0.1
72 0.12
73 0.16
74 0.16
75 0.16
76 0.18
77 0.22
78 0.24
79 0.28
80 0.31
81 0.33
82 0.41
83 0.47
84 0.52
85 0.53
86 0.55
87 0.59
88 0.64
89 0.68
90 0.7
91 0.74
92 0.77
93 0.82
94 0.87