Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UZQ2

Protein Details
Accession A0A397UZQ2    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
42-70TEESGKPKTIKARSKKKRKIETSVNRTLSHydrophilic
NLS Segment(s)
PositionSequence
47-60KPKTIKARSKKKRK
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR021027  Transposase_put_HTH  
Pfam View protein in Pfam  
PF12323  HTH_OrfB_IS605  
Amino Acid Sequences MMSVQTSDSADSHLTSLNLCSHYTLRNSWFSSTNQEEDQLCTEESGKPKTIKARSKKKRKIETSVNRTLSIKTYPNHSQKKILKRWLELMRYAYNTVVRWNKNRRFCNSSKNFEWIKPYTLNEKLKLYTDIKEGKDLNEKDKKLRRSCVWGERKFLRTVVWLELRLKGLHDKVPANIIDESIDDALIARKNIIQKNLKDTKKSFLSFKSKKDLRQTMTIRAQNFSKKDWNHFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.14
4 0.17
5 0.17
6 0.17
7 0.19
8 0.19
9 0.23
10 0.26
11 0.28
12 0.28
13 0.34
14 0.35
15 0.36
16 0.37
17 0.35
18 0.39
19 0.39
20 0.38
21 0.32
22 0.33
23 0.31
24 0.3
25 0.31
26 0.25
27 0.21
28 0.18
29 0.19
30 0.2
31 0.23
32 0.25
33 0.26
34 0.26
35 0.29
36 0.38
37 0.46
38 0.51
39 0.58
40 0.65
41 0.71
42 0.81
43 0.87
44 0.89
45 0.9
46 0.89
47 0.88
48 0.88
49 0.88
50 0.86
51 0.86
52 0.78
53 0.69
54 0.61
55 0.53
56 0.44
57 0.37
58 0.32
59 0.23
60 0.27
61 0.34
62 0.43
63 0.49
64 0.49
65 0.54
66 0.57
67 0.67
68 0.69
69 0.69
70 0.64
71 0.59
72 0.65
73 0.64
74 0.59
75 0.51
76 0.47
77 0.41
78 0.38
79 0.36
80 0.28
81 0.22
82 0.19
83 0.22
84 0.24
85 0.24
86 0.31
87 0.4
88 0.47
89 0.54
90 0.59
91 0.6
92 0.61
93 0.61
94 0.65
95 0.62
96 0.62
97 0.55
98 0.55
99 0.51
100 0.44
101 0.47
102 0.37
103 0.32
104 0.28
105 0.27
106 0.26
107 0.32
108 0.33
109 0.3
110 0.3
111 0.28
112 0.27
113 0.3
114 0.27
115 0.21
116 0.23
117 0.27
118 0.26
119 0.29
120 0.28
121 0.26
122 0.33
123 0.32
124 0.35
125 0.37
126 0.38
127 0.42
128 0.49
129 0.56
130 0.53
131 0.59
132 0.55
133 0.56
134 0.62
135 0.64
136 0.67
137 0.62
138 0.63
139 0.61
140 0.61
141 0.54
142 0.47
143 0.38
144 0.31
145 0.29
146 0.29
147 0.26
148 0.25
149 0.25
150 0.27
151 0.27
152 0.24
153 0.23
154 0.22
155 0.21
156 0.22
157 0.25
158 0.24
159 0.23
160 0.27
161 0.26
162 0.25
163 0.23
164 0.19
165 0.15
166 0.14
167 0.15
168 0.11
169 0.1
170 0.07
171 0.07
172 0.1
173 0.11
174 0.11
175 0.09
176 0.12
177 0.19
178 0.23
179 0.31
180 0.37
181 0.39
182 0.49
183 0.58
184 0.6
185 0.6
186 0.59
187 0.59
188 0.6
189 0.59
190 0.54
191 0.54
192 0.6
193 0.6
194 0.64
195 0.67
196 0.63
197 0.68
198 0.73
199 0.73
200 0.67
201 0.71
202 0.68
203 0.68
204 0.72
205 0.7
206 0.61
207 0.55
208 0.55
209 0.53
210 0.52
211 0.47
212 0.47
213 0.47