Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UAH6

Protein Details
Accession A0A397UAH6    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
113-132PKNFIDQKYKRDKKSNVYSLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 8.5cyto_nucl 8.5, mito 8, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
IPR000719  Prot_kinase_dom  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004672  F:protein kinase activity  
GO:0006468  P:protein phosphorylation  
Pfam View protein in Pfam  
PF00069  Pkinase  
PROSITE View protein in PROSITE  
PS50011  PROTEIN_KINASE_DOM  
Amino Acid Sequences MNDVVESGGSSEKKFLGGMDFVVGFLKPGGAILLADGKDRRLNNNGYCNLVLQYAEDGTLREYLQANFTRLQWNVLIHQRQPKIADFGLSKQISKISSSSGSVIYGMLAYIEPKNFIDQKYKRDKKSNVYSLGVILWEISSGRPPFSSFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.14
4 0.14
5 0.14
6 0.14
7 0.13
8 0.13
9 0.13
10 0.12
11 0.09
12 0.08
13 0.07
14 0.05
15 0.05
16 0.05
17 0.04
18 0.04
19 0.05
20 0.09
21 0.09
22 0.11
23 0.12
24 0.13
25 0.18
26 0.19
27 0.22
28 0.23
29 0.29
30 0.33
31 0.41
32 0.41
33 0.4
34 0.39
35 0.36
36 0.31
37 0.26
38 0.2
39 0.11
40 0.11
41 0.07
42 0.07
43 0.07
44 0.06
45 0.07
46 0.08
47 0.07
48 0.08
49 0.09
50 0.09
51 0.14
52 0.15
53 0.16
54 0.16
55 0.17
56 0.19
57 0.18
58 0.19
59 0.15
60 0.15
61 0.16
62 0.2
63 0.21
64 0.21
65 0.27
66 0.27
67 0.27
68 0.29
69 0.27
70 0.25
71 0.23
72 0.24
73 0.18
74 0.19
75 0.26
76 0.24
77 0.23
78 0.2
79 0.22
80 0.19
81 0.19
82 0.18
83 0.12
84 0.14
85 0.15
86 0.15
87 0.14
88 0.13
89 0.12
90 0.12
91 0.09
92 0.07
93 0.06
94 0.05
95 0.04
96 0.05
97 0.07
98 0.07
99 0.08
100 0.09
101 0.13
102 0.16
103 0.18
104 0.27
105 0.3
106 0.4
107 0.5
108 0.58
109 0.62
110 0.69
111 0.74
112 0.74
113 0.81
114 0.8
115 0.75
116 0.69
117 0.62
118 0.53
119 0.47
120 0.37
121 0.26
122 0.17
123 0.1
124 0.08
125 0.07
126 0.07
127 0.13
128 0.14
129 0.15
130 0.16