Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2M4C6

Protein Details
Accession E2M4C6   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
57-87QVPVAPRRRVKKGPKRLKKHIQKHKTAEELDBasic
NLS Segment(s)
PositionSequence
62-81PRRRVKKGPKRLKKHIQKHK
Subcellular Location(s) cyto 12, cyto_nucl 11.833, nucl 9.5, mito_nucl 7.166, cyto_pero 7.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR025715  FoP_C  
Gene Ontology GO:0003723  F:RNA binding  
KEGG mpr:MPER_15161  -  
Pfam View protein in Pfam  
PF13865  FoP_duplication  
Amino Acid Sequences KYDGKFVDGRRPIKIELITDGASARQETFGCVSIIKQAAAAARIAANANASPSTNTQVPVAPRRRVKKGPKRLKKHIQKHKTAEELDKEMEDYRAAAVEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.36
3 0.31
4 0.32
5 0.28
6 0.24
7 0.23
8 0.18
9 0.16
10 0.15
11 0.12
12 0.1
13 0.09
14 0.1
15 0.12
16 0.12
17 0.12
18 0.12
19 0.11
20 0.14
21 0.14
22 0.13
23 0.11
24 0.1
25 0.11
26 0.11
27 0.11
28 0.07
29 0.06
30 0.07
31 0.07
32 0.06
33 0.06
34 0.05
35 0.06
36 0.06
37 0.06
38 0.06
39 0.07
40 0.1
41 0.1
42 0.11
43 0.11
44 0.13
45 0.16
46 0.24
47 0.29
48 0.33
49 0.39
50 0.44
51 0.51
52 0.58
53 0.66
54 0.68
55 0.74
56 0.79
57 0.83
58 0.87
59 0.9
60 0.92
61 0.91
62 0.91
63 0.91
64 0.9
65 0.89
66 0.88
67 0.86
68 0.82
69 0.75
70 0.72
71 0.66
72 0.6
73 0.52
74 0.44
75 0.37
76 0.31
77 0.28
78 0.21
79 0.16
80 0.12