Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397UYX7

Protein Details
Accession A0A397UYX7    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
261-280EKSVVEVPKKNKDRKALKKKBasic
NLS Segment(s)
PositionSequence
268-280PKKNKDRKALKKK
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MFACKFVIENLEQHVTVSCTNVIAVGDSNHEFEANEIPISVPHCMFHVIVSREPKECGESTYFEAGCYQYNSHTNSKNVHMKLRIFYPTNAPRFSYLRANSSIRTGRSFIVSGFISRITSDFVIFEVTDIDFMTSNINIVQDAQLSITLTVSEHRSDIDMIAEDTDSNIPQAVKRLRKLTSRPLNQSSGLSTINDKSAAPSQDPGPSTNIGTDTVRIQKNKNKLSDLALNLLEPLTVDSAHDSRVRVEDAPEDDDEFEILEKSVVEVPKKNKDRKALKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.21
3 0.2
4 0.2
5 0.15
6 0.12
7 0.12
8 0.12
9 0.11
10 0.1
11 0.1
12 0.09
13 0.12
14 0.13
15 0.15
16 0.14
17 0.14
18 0.13
19 0.13
20 0.16
21 0.14
22 0.13
23 0.12
24 0.12
25 0.13
26 0.15
27 0.16
28 0.12
29 0.11
30 0.12
31 0.14
32 0.13
33 0.14
34 0.2
35 0.21
36 0.26
37 0.32
38 0.34
39 0.33
40 0.35
41 0.34
42 0.3
43 0.28
44 0.27
45 0.24
46 0.24
47 0.26
48 0.31
49 0.29
50 0.25
51 0.26
52 0.22
53 0.21
54 0.2
55 0.17
56 0.14
57 0.19
58 0.23
59 0.28
60 0.31
61 0.32
62 0.34
63 0.4
64 0.45
65 0.43
66 0.45
67 0.44
68 0.43
69 0.43
70 0.44
71 0.41
72 0.35
73 0.34
74 0.38
75 0.41
76 0.42
77 0.41
78 0.37
79 0.36
80 0.35
81 0.37
82 0.36
83 0.3
84 0.29
85 0.32
86 0.33
87 0.3
88 0.34
89 0.35
90 0.28
91 0.28
92 0.26
93 0.23
94 0.23
95 0.23
96 0.17
97 0.16
98 0.15
99 0.13
100 0.12
101 0.11
102 0.09
103 0.09
104 0.09
105 0.08
106 0.08
107 0.08
108 0.07
109 0.07
110 0.08
111 0.07
112 0.07
113 0.06
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.06
121 0.05
122 0.05
123 0.05
124 0.05
125 0.05
126 0.05
127 0.05
128 0.04
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.04
135 0.04
136 0.04
137 0.05
138 0.07
139 0.07
140 0.07
141 0.07
142 0.08
143 0.08
144 0.08
145 0.08
146 0.07
147 0.06
148 0.06
149 0.06
150 0.05
151 0.06
152 0.06
153 0.05
154 0.05
155 0.06
156 0.06
157 0.06
158 0.13
159 0.2
160 0.24
161 0.28
162 0.33
163 0.36
164 0.43
165 0.48
166 0.52
167 0.56
168 0.58
169 0.62
170 0.62
171 0.61
172 0.55
173 0.5
174 0.41
175 0.33
176 0.27
177 0.2
178 0.17
179 0.15
180 0.15
181 0.15
182 0.13
183 0.12
184 0.17
185 0.18
186 0.17
187 0.18
188 0.19
189 0.23
190 0.24
191 0.23
192 0.21
193 0.2
194 0.2
195 0.19
196 0.19
197 0.16
198 0.15
199 0.15
200 0.15
201 0.22
202 0.26
203 0.27
204 0.32
205 0.37
206 0.46
207 0.52
208 0.54
209 0.51
210 0.48
211 0.52
212 0.54
213 0.49
214 0.44
215 0.37
216 0.31
217 0.27
218 0.25
219 0.19
220 0.11
221 0.1
222 0.07
223 0.06
224 0.07
225 0.1
226 0.11
227 0.14
228 0.16
229 0.15
230 0.17
231 0.2
232 0.22
233 0.19
234 0.2
235 0.23
236 0.24
237 0.27
238 0.26
239 0.24
240 0.23
241 0.22
242 0.2
243 0.15
244 0.12
245 0.09
246 0.08
247 0.07
248 0.07
249 0.08
250 0.13
251 0.16
252 0.2
253 0.26
254 0.33
255 0.44
256 0.54
257 0.61
258 0.63
259 0.7
260 0.78