Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397U7F8

Protein Details
Accession A0A397U7F8    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
69-88NPEYHKPRGRPPKRLKSAIEBasic
NLS Segment(s)
PositionSequence
74-84KPRGRPPKRLK
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MAEDVTAELTGLLTQFLMKYHRNTGLNIKEVHYSMSQSNKIQESYSIVADSERQVLSNNTSCNLPEISNPEYHKPRGRPPKRLKSAIEEDNNKHKLSSSKTCGYCQEKEHNVRGCAKQKADSVDKVNCK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.07
4 0.12
5 0.15
6 0.18
7 0.24
8 0.31
9 0.32
10 0.34
11 0.42
12 0.44
13 0.46
14 0.44
15 0.4
16 0.35
17 0.34
18 0.34
19 0.25
20 0.21
21 0.19
22 0.24
23 0.25
24 0.24
25 0.28
26 0.27
27 0.27
28 0.25
29 0.23
30 0.21
31 0.19
32 0.19
33 0.15
34 0.13
35 0.12
36 0.13
37 0.13
38 0.11
39 0.09
40 0.09
41 0.09
42 0.1
43 0.14
44 0.16
45 0.16
46 0.14
47 0.14
48 0.14
49 0.15
50 0.15
51 0.12
52 0.09
53 0.13
54 0.14
55 0.18
56 0.19
57 0.23
58 0.25
59 0.28
60 0.33
61 0.32
62 0.4
63 0.47
64 0.53
65 0.59
66 0.67
67 0.75
68 0.77
69 0.81
70 0.74
71 0.71
72 0.71
73 0.68
74 0.65
75 0.59
76 0.55
77 0.58
78 0.58
79 0.49
80 0.42
81 0.36
82 0.34
83 0.36
84 0.41
85 0.39
86 0.45
87 0.48
88 0.5
89 0.56
90 0.57
91 0.54
92 0.5
93 0.52
94 0.53
95 0.57
96 0.62
97 0.61
98 0.59
99 0.61
100 0.64
101 0.63
102 0.61
103 0.57
104 0.55
105 0.53
106 0.57
107 0.56
108 0.54
109 0.53