Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397W029

Protein Details
Accession A0A397W029    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
92-119DIPKYKELKKPTKLLKNQPKNGKQLAKRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 5
Family & Domain DBs
Amino Acid Sequences MNKAEENRTHKELTKKLPKLTKNLLENLLETMKNPPKINERTHDKLTEELAKETKKWQTICRKTPPKITNLLKNLLEDPLKCEESKKQICEDIPKYKELKKPTKLLKNQPKNGKQLAKRTCQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.64
3 0.67
4 0.73
5 0.72
6 0.71
7 0.73
8 0.71
9 0.65
10 0.64
11 0.59
12 0.52
13 0.47
14 0.42
15 0.35
16 0.26
17 0.21
18 0.24
19 0.26
20 0.29
21 0.29
22 0.3
23 0.36
24 0.42
25 0.47
26 0.47
27 0.5
28 0.52
29 0.55
30 0.54
31 0.46
32 0.42
33 0.4
34 0.37
35 0.3
36 0.26
37 0.26
38 0.24
39 0.23
40 0.25
41 0.26
42 0.25
43 0.26
44 0.31
45 0.39
46 0.47
47 0.54
48 0.61
49 0.66
50 0.64
51 0.72
52 0.67
53 0.6
54 0.6
55 0.57
56 0.55
57 0.5
58 0.51
59 0.42
60 0.4
61 0.37
62 0.3
63 0.27
64 0.19
65 0.19
66 0.19
67 0.2
68 0.19
69 0.2
70 0.22
71 0.31
72 0.37
73 0.36
74 0.34
75 0.37
76 0.4
77 0.47
78 0.49
79 0.49
80 0.45
81 0.47
82 0.47
83 0.5
84 0.53
85 0.54
86 0.57
87 0.55
88 0.62
89 0.68
90 0.75
91 0.78
92 0.83
93 0.85
94 0.86
95 0.88
96 0.89
97 0.87
98 0.84
99 0.84
100 0.82
101 0.79
102 0.78
103 0.78