Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397UX08

Protein Details
Accession A0A397UX08    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
768-791RVQKYGLKKKVQSVKNCRNIGKKDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR006680  Amidohydro-rel  
IPR011059  Metal-dep_hydrolase_composite  
IPR032466  Metal_Hydrolase  
IPR008221  Urease  
IPR011612  Urease_alpha_N_dom  
IPR017950  Urease_AS  
IPR005848  Urease_asu  
IPR017951  Urease_asu_c  
IPR002019  Urease_beta-like  
IPR036461  Urease_betasu_sf  
IPR002026  Urease_gamma/gamma-beta_su  
IPR036463  Urease_gamma_sf  
Gene Ontology GO:0035550  C:urease complex  
GO:0016151  F:nickel cation binding  
GO:0009039  F:urease activity  
GO:0043419  P:urea catabolic process  
Pfam View protein in Pfam  
PF01979  Amidohydro_1  
PF00449  Urease_alpha  
PF00699  Urease_beta  
PF00547  Urease_gamma  
PROSITE View protein in PROSITE  
PS00145  UREASE_2  
PS51368  UREASE_3  
CDD cd00375  Urease_alpha  
cd00407  Urease_beta  
cd00390  Urease_gamma  
Amino Acid Sequences MKLVPRELDKLILNQVGFLAQKRLARGVKLNHTEATALIASQLIELMRDGTYSVADLMNLGKQLLGRRHVQPDVLETLCEVQVEGTFPDGTYLVTVHDPICTDDGNLELALYGSFLPIPDQSKFPIPTSETTKESAPGAMVVKPGKIILNEGRHRVAVKVTNCGDRPIQIGSHYHFIETNPALSFDRHLAYGKRLDIPAGSAVRFEPGDTKTVTLVDIGGKKYISGGNDLACGVVDHSKLDSFVKALIGKGFSHHPQSDKSLSCNPYSIDRAAYADIYGPTVGDRLRLGNTNLWLEIEKDYTVYGDECKFGGGKVLREGMGQSTSVTDTDALDLVITNAVIVDWSGIYKADIGIKGGHIAGIGKAGNPDVMDGVTPGMVVGATTEALAGEGHIFVAGAIDCHIHFICPQIIPEALSSGITTLIGGGTGPNTGTNATTCTPGATHVEMMLSSTDDIPMNFGFTGKGNASDPEALREQVKAGVMGLKLHEDWGTTPKAIDTCLSVSEEYDVQVNIHTDTLNESGFVEQTIAAFKNRTIHAYHSEGAGGGHAPDIIRVCGEPNVIPSSTNPTRPYTANTLDEHVDMLMVCHHLDRNIPEDIAFAESRIRAETIAAEDILHDMGAISIISSDSQAMGRVGEVVLRTWKTAHKMKSQRGRLGTDDDGPADNFRIKRYVAKYTINPAIANGISHLVGSIEKGKVADLVMYSPAFFGTKPEIVIKSGIIVWSQMGDANASIPTTQPVISRPMFGAYGSAASKNSYAFVSLASIYRVQKYGLKKKVQSVKNCRNIGKKDMKLNASLPKIEVDPETYVVKADGVVIKCEPAKELPLTQTVYLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.23
4 0.22
5 0.2
6 0.19
7 0.19
8 0.22
9 0.24
10 0.32
11 0.32
12 0.36
13 0.42
14 0.47
15 0.53
16 0.57
17 0.58
18 0.51
19 0.49
20 0.45
21 0.37
22 0.33
23 0.23
24 0.16
25 0.13
26 0.12
27 0.11
28 0.1
29 0.11
30 0.07
31 0.07
32 0.07
33 0.08
34 0.08
35 0.08
36 0.08
37 0.07
38 0.08
39 0.08
40 0.09
41 0.08
42 0.08
43 0.08
44 0.09
45 0.11
46 0.11
47 0.1
48 0.1
49 0.12
50 0.19
51 0.24
52 0.27
53 0.3
54 0.36
55 0.42
56 0.43
57 0.44
58 0.39
59 0.38
60 0.39
61 0.35
62 0.29
63 0.23
64 0.23
65 0.21
66 0.19
67 0.14
68 0.09
69 0.1
70 0.11
71 0.11
72 0.11
73 0.1
74 0.1
75 0.11
76 0.11
77 0.1
78 0.09
79 0.09
80 0.09
81 0.09
82 0.11
83 0.1
84 0.11
85 0.11
86 0.13
87 0.14
88 0.13
89 0.12
90 0.12
91 0.12
92 0.12
93 0.11
94 0.09
95 0.07
96 0.07
97 0.07
98 0.07
99 0.06
100 0.05
101 0.05
102 0.05
103 0.07
104 0.09
105 0.13
106 0.14
107 0.16
108 0.18
109 0.25
110 0.28
111 0.28
112 0.31
113 0.31
114 0.34
115 0.41
116 0.43
117 0.38
118 0.38
119 0.37
120 0.33
121 0.3
122 0.26
123 0.18
124 0.16
125 0.15
126 0.15
127 0.17
128 0.17
129 0.16
130 0.16
131 0.17
132 0.16
133 0.15
134 0.18
135 0.22
136 0.31
137 0.35
138 0.39
139 0.39
140 0.38
141 0.39
142 0.35
143 0.33
144 0.31
145 0.28
146 0.33
147 0.34
148 0.39
149 0.39
150 0.41
151 0.36
152 0.3
153 0.31
154 0.25
155 0.23
156 0.18
157 0.21
158 0.21
159 0.26
160 0.25
161 0.23
162 0.22
163 0.21
164 0.26
165 0.23
166 0.22
167 0.16
168 0.18
169 0.19
170 0.18
171 0.2
172 0.16
173 0.16
174 0.15
175 0.17
176 0.17
177 0.2
178 0.25
179 0.25
180 0.26
181 0.25
182 0.25
183 0.23
184 0.23
185 0.24
186 0.21
187 0.19
188 0.16
189 0.16
190 0.17
191 0.17
192 0.15
193 0.14
194 0.13
195 0.16
196 0.16
197 0.17
198 0.15
199 0.16
200 0.16
201 0.11
202 0.11
203 0.12
204 0.15
205 0.15
206 0.16
207 0.15
208 0.15
209 0.17
210 0.18
211 0.15
212 0.14
213 0.15
214 0.15
215 0.16
216 0.16
217 0.14
218 0.12
219 0.11
220 0.08
221 0.1
222 0.09
223 0.09
224 0.09
225 0.1
226 0.11
227 0.12
228 0.11
229 0.09
230 0.1
231 0.12
232 0.12
233 0.12
234 0.13
235 0.14
236 0.13
237 0.15
238 0.17
239 0.17
240 0.22
241 0.23
242 0.24
243 0.25
244 0.3
245 0.34
246 0.31
247 0.34
248 0.36
249 0.36
250 0.35
251 0.34
252 0.3
253 0.29
254 0.3
255 0.27
256 0.2
257 0.18
258 0.19
259 0.18
260 0.17
261 0.12
262 0.11
263 0.1
264 0.1
265 0.09
266 0.07
267 0.07
268 0.08
269 0.08
270 0.07
271 0.07
272 0.08
273 0.1
274 0.12
275 0.14
276 0.16
277 0.18
278 0.18
279 0.18
280 0.17
281 0.16
282 0.15
283 0.14
284 0.12
285 0.1
286 0.09
287 0.09
288 0.08
289 0.09
290 0.08
291 0.09
292 0.09
293 0.09
294 0.09
295 0.1
296 0.09
297 0.09
298 0.14
299 0.14
300 0.15
301 0.16
302 0.18
303 0.18
304 0.18
305 0.19
306 0.14
307 0.13
308 0.11
309 0.09
310 0.08
311 0.09
312 0.08
313 0.08
314 0.07
315 0.06
316 0.07
317 0.07
318 0.06
319 0.05
320 0.05
321 0.05
322 0.04
323 0.04
324 0.03
325 0.03
326 0.03
327 0.03
328 0.03
329 0.03
330 0.02
331 0.03
332 0.03
333 0.03
334 0.04
335 0.04
336 0.05
337 0.07
338 0.07
339 0.08
340 0.08
341 0.09
342 0.09
343 0.09
344 0.08
345 0.06
346 0.06
347 0.05
348 0.06
349 0.06
350 0.06
351 0.06
352 0.06
353 0.06
354 0.06
355 0.06
356 0.05
357 0.05
358 0.04
359 0.04
360 0.04
361 0.04
362 0.04
363 0.03
364 0.03
365 0.03
366 0.02
367 0.02
368 0.03
369 0.03
370 0.03
371 0.03
372 0.03
373 0.03
374 0.03
375 0.03
376 0.03
377 0.03
378 0.03
379 0.03
380 0.03
381 0.03
382 0.03
383 0.03
384 0.03
385 0.03
386 0.04
387 0.04
388 0.05
389 0.05
390 0.05
391 0.05
392 0.07
393 0.09
394 0.09
395 0.09
396 0.09
397 0.09
398 0.09
399 0.09
400 0.08
401 0.06
402 0.06
403 0.06
404 0.05
405 0.05
406 0.04
407 0.04
408 0.03
409 0.03
410 0.03
411 0.03
412 0.02
413 0.03
414 0.03
415 0.03
416 0.03
417 0.04
418 0.04
419 0.04
420 0.05
421 0.07
422 0.08
423 0.09
424 0.09
425 0.09
426 0.08
427 0.09
428 0.11
429 0.09
430 0.09
431 0.08
432 0.08
433 0.08
434 0.08
435 0.07
436 0.05
437 0.05
438 0.05
439 0.05
440 0.05
441 0.06
442 0.07
443 0.06
444 0.07
445 0.06
446 0.07
447 0.06
448 0.07
449 0.09
450 0.08
451 0.09
452 0.09
453 0.09
454 0.11
455 0.13
456 0.13
457 0.13
458 0.14
459 0.13
460 0.13
461 0.13
462 0.12
463 0.11
464 0.11
465 0.08
466 0.08
467 0.1
468 0.1
469 0.1
470 0.1
471 0.09
472 0.09
473 0.1
474 0.1
475 0.07
476 0.08
477 0.11
478 0.12
479 0.11
480 0.11
481 0.11
482 0.12
483 0.12
484 0.11
485 0.09
486 0.09
487 0.1
488 0.11
489 0.1
490 0.1
491 0.1
492 0.1
493 0.09
494 0.09
495 0.07
496 0.06
497 0.07
498 0.08
499 0.07
500 0.07
501 0.07
502 0.06
503 0.08
504 0.1
505 0.09
506 0.08
507 0.08
508 0.08
509 0.08
510 0.08
511 0.06
512 0.05
513 0.05
514 0.07
515 0.08
516 0.08
517 0.08
518 0.09
519 0.14
520 0.15
521 0.17
522 0.17
523 0.19
524 0.24
525 0.27
526 0.27
527 0.22
528 0.21
529 0.19
530 0.17
531 0.14
532 0.09
533 0.05
534 0.05
535 0.05
536 0.05
537 0.06
538 0.07
539 0.06
540 0.06
541 0.06
542 0.07
543 0.08
544 0.1
545 0.09
546 0.11
547 0.13
548 0.13
549 0.13
550 0.13
551 0.21
552 0.22
553 0.27
554 0.27
555 0.27
556 0.3
557 0.31
558 0.34
559 0.32
560 0.34
561 0.33
562 0.32
563 0.31
564 0.3
565 0.28
566 0.24
567 0.18
568 0.13
569 0.09
570 0.08
571 0.07
572 0.06
573 0.06
574 0.06
575 0.07
576 0.08
577 0.1
578 0.12
579 0.14
580 0.15
581 0.15
582 0.14
583 0.14
584 0.14
585 0.15
586 0.13
587 0.1
588 0.11
589 0.11
590 0.12
591 0.13
592 0.12
593 0.09
594 0.1
595 0.11
596 0.11
597 0.12
598 0.11
599 0.1
600 0.1
601 0.1
602 0.1
603 0.08
604 0.05
605 0.04
606 0.04
607 0.04
608 0.04
609 0.03
610 0.03
611 0.04
612 0.04
613 0.04
614 0.04
615 0.05
616 0.05
617 0.06
618 0.06
619 0.06
620 0.06
621 0.07
622 0.07
623 0.08
624 0.08
625 0.08
626 0.13
627 0.13
628 0.14
629 0.15
630 0.19
631 0.24
632 0.31
633 0.37
634 0.42
635 0.51
636 0.6
637 0.68
638 0.73
639 0.74
640 0.72
641 0.7
642 0.63
643 0.59
644 0.52
645 0.45
646 0.38
647 0.32
648 0.28
649 0.24
650 0.22
651 0.17
652 0.19
653 0.17
654 0.17
655 0.19
656 0.19
657 0.26
658 0.3
659 0.38
660 0.39
661 0.44
662 0.46
663 0.5
664 0.55
665 0.49
666 0.44
667 0.35
668 0.33
669 0.27
670 0.23
671 0.17
672 0.13
673 0.11
674 0.11
675 0.1
676 0.07
677 0.07
678 0.08
679 0.12
680 0.11
681 0.11
682 0.12
683 0.12
684 0.13
685 0.13
686 0.13
687 0.09
688 0.11
689 0.12
690 0.12
691 0.12
692 0.11
693 0.11
694 0.1
695 0.09
696 0.11
697 0.14
698 0.15
699 0.17
700 0.21
701 0.22
702 0.23
703 0.24
704 0.21
705 0.17
706 0.17
707 0.16
708 0.12
709 0.11
710 0.1
711 0.1
712 0.1
713 0.09
714 0.08
715 0.08
716 0.08
717 0.09
718 0.09
719 0.08
720 0.08
721 0.07
722 0.09
723 0.1
724 0.11
725 0.11
726 0.13
727 0.2
728 0.2
729 0.22
730 0.21
731 0.23
732 0.22
733 0.2
734 0.19
735 0.13
736 0.16
737 0.15
738 0.16
739 0.13
740 0.14
741 0.15
742 0.15
743 0.15
744 0.12
745 0.12
746 0.11
747 0.11
748 0.12
749 0.13
750 0.13
751 0.14
752 0.18
753 0.19
754 0.21
755 0.22
756 0.21
757 0.26
758 0.35
759 0.44
760 0.49
761 0.56
762 0.58
763 0.66
764 0.75
765 0.77
766 0.78
767 0.79
768 0.8
769 0.81
770 0.83
771 0.81
772 0.8
773 0.78
774 0.77
775 0.77
776 0.72
777 0.72
778 0.73
779 0.69
780 0.64
781 0.64
782 0.62
783 0.56
784 0.51
785 0.43
786 0.37
787 0.35
788 0.32
789 0.28
790 0.24
791 0.21
792 0.22
793 0.23
794 0.2
795 0.2
796 0.18
797 0.17
798 0.13
799 0.14
800 0.18
801 0.17
802 0.2
803 0.2
804 0.23
805 0.25
806 0.25
807 0.24
808 0.21
809 0.25
810 0.26
811 0.3
812 0.3
813 0.34
814 0.37