Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UL01

Protein Details
Accession A0A397UL01    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
50-72DHWKLWKASSKKRKMNLKRDFSHHydrophilic
NLS Segment(s)
PositionSequence
60-63KKRK
Subcellular Location(s) nucl 20, mito_nucl 13.333, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013761  SAM/pointed_sf  
Amino Acid Sequences MLSTLKTGRILKRKNLSYILENIKKDLEKVANSESEFDEERRNKAQEIIDHWKLWKASSKKRKMNLKRDFSHFKINSLKVKQHMVATGSNAIQISNSRKHLRNNHGEPVKISSEKIVECDLDFNETDVRDQDLTGRAFLRLTEEKLTRKPGFYELKPSPAESIMELVEELNKKLEKHHQSRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.69
3 0.65
4 0.59
5 0.61
6 0.62
7 0.58
8 0.53
9 0.48
10 0.46
11 0.42
12 0.38
13 0.35
14 0.31
15 0.26
16 0.29
17 0.31
18 0.31
19 0.31
20 0.33
21 0.27
22 0.25
23 0.25
24 0.23
25 0.28
26 0.26
27 0.3
28 0.33
29 0.33
30 0.31
31 0.34
32 0.37
33 0.32
34 0.38
35 0.42
36 0.4
37 0.4
38 0.39
39 0.38
40 0.34
41 0.31
42 0.31
43 0.3
44 0.38
45 0.47
46 0.57
47 0.61
48 0.69
49 0.79
50 0.81
51 0.85
52 0.85
53 0.84
54 0.78
55 0.78
56 0.77
57 0.69
58 0.69
59 0.59
60 0.53
61 0.5
62 0.49
63 0.49
64 0.45
65 0.45
66 0.36
67 0.39
68 0.36
69 0.29
70 0.27
71 0.22
72 0.2
73 0.18
74 0.17
75 0.14
76 0.14
77 0.12
78 0.1
79 0.08
80 0.09
81 0.13
82 0.14
83 0.19
84 0.22
85 0.26
86 0.32
87 0.41
88 0.48
89 0.53
90 0.54
91 0.59
92 0.57
93 0.55
94 0.49
95 0.45
96 0.39
97 0.3
98 0.25
99 0.18
100 0.18
101 0.17
102 0.18
103 0.15
104 0.12
105 0.11
106 0.13
107 0.12
108 0.12
109 0.12
110 0.11
111 0.12
112 0.11
113 0.12
114 0.11
115 0.12
116 0.1
117 0.1
118 0.12
119 0.16
120 0.16
121 0.17
122 0.17
123 0.15
124 0.15
125 0.15
126 0.19
127 0.17
128 0.19
129 0.24
130 0.27
131 0.31
132 0.36
133 0.44
134 0.4
135 0.39
136 0.38
137 0.41
138 0.45
139 0.43
140 0.48
141 0.43
142 0.48
143 0.47
144 0.46
145 0.4
146 0.33
147 0.32
148 0.23
149 0.22
150 0.15
151 0.14
152 0.13
153 0.11
154 0.14
155 0.15
156 0.14
157 0.17
158 0.2
159 0.19
160 0.25
161 0.35
162 0.41