Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397U6C4

Protein Details
Accession A0A397U6C4    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
121-160TSLGKVKCTKKIKTNNVRIVKVDRKKRIRMDPKDLKQVQRHydrophilic
NLS Segment(s)
PositionSequence
144-147RKKR
Subcellular Location(s) nucl 20, mito_nucl 13.333, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
Amino Acid Sequences MNLKYIEQCTKRDNSATLKWFNLPQTTLRVIKGKGPKWYRELRNEIEEKYIRGSETLITPNPWTSKGILSKMNWIVEKAINRNFLGRIILIKNNMAVANHWIIQNLNHQLAPCKDCYQNNTSLGKVKCTKKIKTNNVRIVKVDRKKRIRMDPKDLKQVQRSYEKGECKKIYNNKKGNHD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.49
3 0.52
4 0.5
5 0.47
6 0.46
7 0.46
8 0.44
9 0.4
10 0.33
11 0.29
12 0.31
13 0.34
14 0.34
15 0.33
16 0.34
17 0.31
18 0.37
19 0.43
20 0.42
21 0.47
22 0.5
23 0.53
24 0.55
25 0.64
26 0.64
27 0.64
28 0.67
29 0.62
30 0.64
31 0.62
32 0.56
33 0.54
34 0.47
35 0.39
36 0.34
37 0.31
38 0.22
39 0.2
40 0.19
41 0.13
42 0.15
43 0.17
44 0.15
45 0.15
46 0.16
47 0.18
48 0.19
49 0.18
50 0.16
51 0.14
52 0.19
53 0.21
54 0.24
55 0.26
56 0.25
57 0.31
58 0.32
59 0.33
60 0.28
61 0.25
62 0.24
63 0.22
64 0.24
65 0.22
66 0.23
67 0.23
68 0.23
69 0.24
70 0.22
71 0.2
72 0.18
73 0.14
74 0.12
75 0.12
76 0.13
77 0.12
78 0.12
79 0.12
80 0.12
81 0.12
82 0.09
83 0.08
84 0.09
85 0.09
86 0.11
87 0.11
88 0.1
89 0.1
90 0.11
91 0.15
92 0.15
93 0.15
94 0.14
95 0.14
96 0.17
97 0.2
98 0.21
99 0.18
100 0.19
101 0.22
102 0.23
103 0.28
104 0.3
105 0.33
106 0.36
107 0.36
108 0.34
109 0.38
110 0.36
111 0.38
112 0.41
113 0.39
114 0.43
115 0.49
116 0.54
117 0.56
118 0.66
119 0.71
120 0.75
121 0.81
122 0.81
123 0.82
124 0.79
125 0.72
126 0.7
127 0.69
128 0.67
129 0.66
130 0.66
131 0.66
132 0.73
133 0.78
134 0.81
135 0.82
136 0.83
137 0.84
138 0.85
139 0.84
140 0.86
141 0.83
142 0.78
143 0.76
144 0.72
145 0.67
146 0.65
147 0.6
148 0.57
149 0.59
150 0.62
151 0.61
152 0.65
153 0.63
154 0.59
155 0.66
156 0.69
157 0.72
158 0.73
159 0.75