Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397V665

Protein Details
Accession A0A397V665    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
65-92RVCIYEKSTKKRGPRPKSKKTPMLVNILHydrophilic
NLS Segment(s)
PositionSequence
73-84TKKRGPRPKSKK
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MNLVRILPHPMQYDPMTLPQPCSHQPKITIKTNRLYTKVACTNCRKKKEKCTGEARCANCCRRNRVCIYEKSTKKRGPRPKSKKTPMLVNILN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.27
4 0.25
5 0.27
6 0.25
7 0.29
8 0.31
9 0.37
10 0.36
11 0.36
12 0.43
13 0.5
14 0.54
15 0.58
16 0.6
17 0.56
18 0.6
19 0.64
20 0.61
21 0.54
22 0.51
23 0.42
24 0.43
25 0.46
26 0.41
27 0.39
28 0.44
29 0.51
30 0.57
31 0.65
32 0.64
33 0.64
34 0.72
35 0.77
36 0.76
37 0.73
38 0.75
39 0.73
40 0.75
41 0.75
42 0.67
43 0.63
44 0.61
45 0.6
46 0.56
47 0.54
48 0.54
49 0.54
50 0.58
51 0.57
52 0.6
53 0.61
54 0.63
55 0.65
56 0.67
57 0.69
58 0.7
59 0.73
60 0.7
61 0.72
62 0.74
63 0.77
64 0.78
65 0.81
66 0.84
67 0.87
68 0.92
69 0.93
70 0.92
71 0.87
72 0.87
73 0.81