Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397UAT4

Protein Details
Accession A0A397UAT4    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
65-84GSQKNFLKEKKKRSRLLDSNHydrophilic
NLS Segment(s)
PositionSequence
75-75K
Subcellular Location(s) nucl 16, cyto_nucl 12.333, mito_nucl 10.499, cyto 5.5, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
Amino Acid Sequences MNYENVVEWIPFNRLENVQKVGKGGFGSVFSAMCLDGKRIVSGESHHSVQLCTLSFIVALKILPGSQKNFLKEKKKRSRLLDSNLEVYRLNQTTTNNEYLMVFNMQIKEAFIMSNKESVNMKSEQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.26
3 0.29
4 0.32
5 0.32
6 0.32
7 0.31
8 0.28
9 0.26
10 0.21
11 0.18
12 0.14
13 0.12
14 0.13
15 0.12
16 0.12
17 0.09
18 0.09
19 0.08
20 0.08
21 0.08
22 0.08
23 0.1
24 0.11
25 0.11
26 0.11
27 0.12
28 0.12
29 0.13
30 0.18
31 0.18
32 0.18
33 0.19
34 0.18
35 0.18
36 0.17
37 0.17
38 0.12
39 0.09
40 0.08
41 0.08
42 0.07
43 0.07
44 0.07
45 0.05
46 0.05
47 0.04
48 0.04
49 0.04
50 0.06
51 0.07
52 0.09
53 0.15
54 0.18
55 0.21
56 0.27
57 0.33
58 0.42
59 0.48
60 0.58
61 0.63
62 0.7
63 0.74
64 0.76
65 0.8
66 0.78
67 0.79
68 0.77
69 0.68
70 0.65
71 0.57
72 0.51
73 0.4
74 0.32
75 0.3
76 0.21
77 0.2
78 0.16
79 0.18
80 0.22
81 0.27
82 0.28
83 0.23
84 0.22
85 0.22
86 0.21
87 0.21
88 0.17
89 0.13
90 0.13
91 0.14
92 0.14
93 0.13
94 0.13
95 0.12
96 0.11
97 0.11
98 0.11
99 0.15
100 0.16
101 0.21
102 0.2
103 0.22
104 0.24
105 0.25
106 0.27