Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397V868

Protein Details
Accession A0A397V868    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
44-79DIERRREIFRERRKKRDAKKPKPKPKHRSSFLLKISBasic
NLS Segment(s)
PositionSequence
47-71RRREIFRERRKKRDAKKPKPKPKHR
Subcellular Location(s) nucl 18, cyto_nucl 14, cyto 6
Family & Domain DBs
Amino Acid Sequences MAVDDPMEVFQVVQNMPKRLIDCHKLIDACFRRRDCISEISQKDIERRREIFRERRKKRDAKKPKPKPKHRSSFLLKISGFMFNHGGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.24
4 0.26
5 0.26
6 0.28
7 0.34
8 0.33
9 0.31
10 0.33
11 0.35
12 0.34
13 0.33
14 0.38
15 0.38
16 0.39
17 0.44
18 0.41
19 0.4
20 0.4
21 0.43
22 0.36
23 0.35
24 0.34
25 0.36
26 0.36
27 0.37
28 0.39
29 0.36
30 0.38
31 0.4
32 0.39
33 0.35
34 0.37
35 0.37
36 0.41
37 0.49
38 0.53
39 0.58
40 0.64
41 0.67
42 0.74
43 0.79
44 0.82
45 0.84
46 0.85
47 0.86
48 0.86
49 0.9
50 0.91
51 0.93
52 0.95
53 0.96
54 0.96
55 0.95
56 0.95
57 0.9
58 0.88
59 0.85
60 0.84
61 0.78
62 0.76
63 0.64
64 0.55
65 0.51
66 0.47
67 0.38
68 0.31