Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UEH9

Protein Details
Accession A0A397UEH9    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
86-115HNRECVYIKPTKKRGPKPKSDKKPIITPALHydrophilic
NLS Segment(s)
PositionSequence
95-108PTKKRGPKPKSDKK
Subcellular Location(s) nucl 22, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MYFNSYYRSSYDQYYNLHSNLHHPYCKICCNSEEISKFNELNERPQPYKSEITKKTRSYVTLACTSCRDKKEKCSGEEICANCKRHNRECVYIKPTKKRGPKPKSDKKPIITPALANLLNPVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.4
3 0.35
4 0.35
5 0.3
6 0.31
7 0.35
8 0.38
9 0.33
10 0.3
11 0.34
12 0.37
13 0.43
14 0.41
15 0.34
16 0.31
17 0.34
18 0.36
19 0.39
20 0.37
21 0.32
22 0.32
23 0.33
24 0.32
25 0.27
26 0.3
27 0.23
28 0.27
29 0.31
30 0.34
31 0.32
32 0.34
33 0.36
34 0.34
35 0.4
36 0.39
37 0.43
38 0.45
39 0.52
40 0.58
41 0.57
42 0.57
43 0.51
44 0.48
45 0.42
46 0.37
47 0.33
48 0.32
49 0.31
50 0.28
51 0.28
52 0.3
53 0.31
54 0.31
55 0.33
56 0.28
57 0.37
58 0.47
59 0.5
60 0.49
61 0.52
62 0.5
63 0.49
64 0.52
65 0.45
66 0.42
67 0.43
68 0.43
69 0.38
70 0.44
71 0.47
72 0.49
73 0.56
74 0.54
75 0.57
76 0.61
77 0.66
78 0.66
79 0.66
80 0.66
81 0.67
82 0.71
83 0.71
84 0.74
85 0.76
86 0.8
87 0.83
88 0.86
89 0.88
90 0.9
91 0.92
92 0.93
93 0.92
94 0.87
95 0.86
96 0.81
97 0.79
98 0.7
99 0.6
100 0.53
101 0.5
102 0.44
103 0.34