Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397V7V9

Protein Details
Accession A0A397V7V9    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
14-40GSKTNGMTRKWNNKKNQIKPEQEKGQKHydrophilic
NLS Segment(s)
PositionSequence
3-48KLLKKFIKKKAGSKTNGMTRKWNNKKNQIKPEQEKGQKWKATKIAK
Subcellular Location(s) nucl 16.5, mito_nucl 13.333, cyto_nucl 10.166, mito 8
Family & Domain DBs
Amino Acid Sequences MKKLLKKFIKKKAGSKTNGMTRKWNNKKNQIKPEQEKGQKWKATKIAKEAENGKIIQKPTDKKLTETSPATVPNDNSNDDFNNGSNDNFNKSFSDASKKININK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.77
3 0.75
4 0.74
5 0.74
6 0.67
7 0.65
8 0.64
9 0.71
10 0.73
11 0.73
12 0.72
13 0.76
14 0.84
15 0.85
16 0.87
17 0.85
18 0.85
19 0.84
20 0.83
21 0.82
22 0.79
23 0.75
24 0.72
25 0.71
26 0.65
27 0.59
28 0.56
29 0.55
30 0.54
31 0.51
32 0.5
33 0.48
34 0.45
35 0.47
36 0.44
37 0.39
38 0.34
39 0.32
40 0.26
41 0.23
42 0.21
43 0.22
44 0.24
45 0.25
46 0.27
47 0.36
48 0.35
49 0.35
50 0.4
51 0.4
52 0.4
53 0.39
54 0.36
55 0.3
56 0.32
57 0.31
58 0.28
59 0.25
60 0.25
61 0.26
62 0.26
63 0.24
64 0.23
65 0.22
66 0.22
67 0.22
68 0.17
69 0.18
70 0.17
71 0.16
72 0.19
73 0.19
74 0.23
75 0.23
76 0.24
77 0.21
78 0.23
79 0.26
80 0.25
81 0.33
82 0.3
83 0.34
84 0.42