Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UJM7

Protein Details
Accession A0A397UJM7    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
152-176VKKIHNSDRIKKRSNNGKIRKTVGGHydrophilic
NLS Segment(s)
PositionSequence
55-79RRKYNEKRIYELGAKKPKGKGIKIP
158-189SDRIKKRSNNGKIRKTVGGSQAKLKKKQKKRK
Subcellular Location(s) nucl 18.5, mito_nucl 13.5, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027973  DUF4602  
Pfam View protein in Pfam  
PF15375  DUF4602  
Amino Acid Sequences MKNSFVKTTNNSFAKTMNMNNSFAKIEQFLSDTTMNNSLDKIEQYLSDQLTGKERRKYNEKRIYELGAKKPKGKGIKIPTPIALGMQAKRQEREKKELQEVKDLGLYHHSIKHNWAGSTSSNKSKKTYRDKGIKMGIGKVKGGILTLSSNDVKKIHNSDRIKKRSNNGKIRKTVGGSQAKLKKKQKKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.4
3 0.37
4 0.37
5 0.36
6 0.37
7 0.37
8 0.38
9 0.35
10 0.31
11 0.28
12 0.2
13 0.18
14 0.16
15 0.17
16 0.14
17 0.17
18 0.18
19 0.16
20 0.17
21 0.21
22 0.2
23 0.19
24 0.19
25 0.16
26 0.16
27 0.16
28 0.15
29 0.11
30 0.11
31 0.14
32 0.17
33 0.17
34 0.18
35 0.18
36 0.17
37 0.24
38 0.3
39 0.33
40 0.36
41 0.39
42 0.43
43 0.52
44 0.61
45 0.64
46 0.68
47 0.66
48 0.64
49 0.64
50 0.63
51 0.6
52 0.57
53 0.56
54 0.54
55 0.53
56 0.52
57 0.51
58 0.52
59 0.51
60 0.47
61 0.47
62 0.46
63 0.53
64 0.53
65 0.52
66 0.47
67 0.42
68 0.39
69 0.3
70 0.24
71 0.17
72 0.13
73 0.16
74 0.2
75 0.2
76 0.21
77 0.28
78 0.34
79 0.36
80 0.42
81 0.45
82 0.45
83 0.53
84 0.57
85 0.52
86 0.51
87 0.48
88 0.41
89 0.37
90 0.32
91 0.23
92 0.2
93 0.2
94 0.13
95 0.18
96 0.18
97 0.16
98 0.18
99 0.23
100 0.23
101 0.22
102 0.22
103 0.18
104 0.19
105 0.26
106 0.27
107 0.31
108 0.34
109 0.36
110 0.38
111 0.42
112 0.5
113 0.54
114 0.6
115 0.6
116 0.66
117 0.68
118 0.72
119 0.72
120 0.66
121 0.57
122 0.54
123 0.49
124 0.41
125 0.37
126 0.3
127 0.24
128 0.2
129 0.19
130 0.12
131 0.09
132 0.09
133 0.09
134 0.13
135 0.14
136 0.14
137 0.16
138 0.17
139 0.17
140 0.21
141 0.28
142 0.31
143 0.39
144 0.47
145 0.56
146 0.65
147 0.73
148 0.76
149 0.75
150 0.78
151 0.79
152 0.82
153 0.82
154 0.82
155 0.83
156 0.82
157 0.81
158 0.77
159 0.7
160 0.66
161 0.65
162 0.64
163 0.56
164 0.58
165 0.62
166 0.64
167 0.7
168 0.73
169 0.74