Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397UGJ4

Protein Details
Accession A0A397UGJ4    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MKINIKKQTKKKIKQKLKLKNVKLTSHydrophilic
NLS Segment(s)
PositionSequence
6-20KKQTKKKIKQKLKLK
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR032675  LRR_dom_sf  
Amino Acid Sequences MKINIKKQTKKKIKQKLKLKNVKLTSLDLRDNQHGPEGGKVIADALCENSALTYLDLRTPSPYIKQLQNIND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.93
3 0.92
4 0.92
5 0.92
6 0.89
7 0.87
8 0.8
9 0.75
10 0.66
11 0.6
12 0.54
13 0.47
14 0.43
15 0.35
16 0.35
17 0.32
18 0.3
19 0.26
20 0.22
21 0.19
22 0.17
23 0.15
24 0.14
25 0.11
26 0.09
27 0.09
28 0.08
29 0.07
30 0.07
31 0.06
32 0.06
33 0.07
34 0.07
35 0.07
36 0.06
37 0.06
38 0.07
39 0.07
40 0.07
41 0.07
42 0.1
43 0.11
44 0.12
45 0.14
46 0.16
47 0.18
48 0.21
49 0.26
50 0.28
51 0.33
52 0.4