Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UB68

Protein Details
Accession A0A397UB68    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
155-185EKKIQDKSKNQDKKSKKNKSKKISSAENIDNHydrophilic
NLS Segment(s)
PositionSequence
159-177QDKSKNQDKKSKKNKSKKI
Subcellular Location(s) nucl 12.5, mito_nucl 12.333, mito 11, cyto_mito 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR005822  Ribosomal_L13  
IPR005823  Ribosomal_L13_bac-type  
IPR036899  Ribosomal_L13_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00572  Ribosomal_L13  
CDD cd00392  Ribosomal_L13  
Amino Acid Sequences MSQAIGNTALAYVRAWHLVDAKQRILGRMSANIATTLMGKHKPIYDPASDCGDYVVVINAKEVAVTGKKAEQKLYRHHSGYPGGLKTISYKIMLEKKPDEIIRKAVSGMLPKNRLRYRRLNRLFIFPDDKHPYEKNILKYYDYTLNELSLPDKVEKKIQDKSKNQDKKSKKNKSKKISSAENIDNGKNKSVKESISDDVKKDKKNKSIEIQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.13
4 0.16
5 0.21
6 0.28
7 0.31
8 0.31
9 0.34
10 0.35
11 0.36
12 0.34
13 0.33
14 0.28
15 0.27
16 0.28
17 0.24
18 0.24
19 0.22
20 0.2
21 0.17
22 0.15
23 0.12
24 0.13
25 0.14
26 0.14
27 0.16
28 0.2
29 0.21
30 0.25
31 0.28
32 0.3
33 0.31
34 0.33
35 0.36
36 0.33
37 0.31
38 0.26
39 0.22
40 0.17
41 0.14
42 0.14
43 0.09
44 0.09
45 0.09
46 0.09
47 0.08
48 0.08
49 0.08
50 0.08
51 0.08
52 0.09
53 0.1
54 0.14
55 0.19
56 0.2
57 0.26
58 0.29
59 0.33
60 0.42
61 0.49
62 0.5
63 0.47
64 0.47
65 0.46
66 0.42
67 0.41
68 0.35
69 0.28
70 0.23
71 0.21
72 0.2
73 0.19
74 0.18
75 0.15
76 0.12
77 0.11
78 0.15
79 0.24
80 0.25
81 0.27
82 0.26
83 0.27
84 0.3
85 0.32
86 0.32
87 0.25
88 0.28
89 0.25
90 0.24
91 0.22
92 0.2
93 0.19
94 0.18
95 0.2
96 0.2
97 0.25
98 0.26
99 0.33
100 0.37
101 0.4
102 0.42
103 0.49
104 0.53
105 0.58
106 0.63
107 0.64
108 0.61
109 0.65
110 0.61
111 0.54
112 0.52
113 0.42
114 0.44
115 0.41
116 0.4
117 0.37
118 0.35
119 0.35
120 0.36
121 0.4
122 0.38
123 0.38
124 0.38
125 0.36
126 0.36
127 0.37
128 0.37
129 0.33
130 0.3
131 0.24
132 0.23
133 0.22
134 0.21
135 0.18
136 0.12
137 0.13
138 0.13
139 0.15
140 0.16
141 0.21
142 0.27
143 0.31
144 0.38
145 0.46
146 0.53
147 0.58
148 0.67
149 0.72
150 0.76
151 0.76
152 0.78
153 0.79
154 0.8
155 0.83
156 0.85
157 0.85
158 0.86
159 0.92
160 0.92
161 0.93
162 0.91
163 0.89
164 0.88
165 0.83
166 0.8
167 0.74
168 0.7
169 0.62
170 0.56
171 0.53
172 0.45
173 0.45
174 0.39
175 0.35
176 0.34
177 0.35
178 0.33
179 0.32
180 0.35
181 0.34
182 0.41
183 0.44
184 0.41
185 0.47
186 0.53
187 0.56
188 0.59
189 0.64
190 0.62
191 0.68
192 0.74