Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397U4T9

Protein Details
Accession A0A397U4T9    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
56-75RELKRKPMGLIKKLRKAKKEBasic
NLS Segment(s)
PositionSequence
50-74RARRFQRELKRKPMGLIKKLRKAKK
Subcellular Location(s) nucl 18, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002222  Ribosomal_S19  
IPR023575  Ribosomal_S19_S15_SF  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Amino Acid Sequences MIFLLINDDEAEQVFAEVKKKRTFKKFSYRGIDQLLDLNSEQLTDLVHARARRFQRELKRKPMGLIKKLRKAKKEAINQQSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.15
4 0.19
5 0.24
6 0.32
7 0.38
8 0.47
9 0.55
10 0.62
11 0.66
12 0.72
13 0.76
14 0.77
15 0.79
16 0.73
17 0.67
18 0.62
19 0.53
20 0.42
21 0.36
22 0.28
23 0.2
24 0.17
25 0.14
26 0.09
27 0.09
28 0.08
29 0.05
30 0.05
31 0.04
32 0.05
33 0.06
34 0.08
35 0.1
36 0.11
37 0.18
38 0.22
39 0.27
40 0.3
41 0.38
42 0.46
43 0.56
44 0.63
45 0.67
46 0.71
47 0.67
48 0.67
49 0.69
50 0.67
51 0.66
52 0.68
53 0.68
54 0.7
55 0.77
56 0.8
57 0.78
58 0.76
59 0.77
60 0.76
61 0.77
62 0.78