Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397W4X1

Protein Details
Accession A0A397W4X1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
66-86QVKVTKCYEKCNKKDNTYNAYHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 22, golg 3
Family & Domain DBs
Amino Acid Sequences MKANFIFFFVTVFLFALASANPRPFRRSPQTEAQYCTVDCQNAYKKCISGTTGYGYNDVSAQNDCQVKVTKCYEKCNKKDNTYNAY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.06
5 0.09
6 0.1
7 0.15
8 0.18
9 0.2
10 0.25
11 0.27
12 0.35
13 0.42
14 0.48
15 0.49
16 0.56
17 0.62
18 0.6
19 0.61
20 0.55
21 0.47
22 0.4
23 0.36
24 0.27
25 0.19
26 0.16
27 0.17
28 0.22
29 0.23
30 0.25
31 0.24
32 0.23
33 0.23
34 0.25
35 0.22
36 0.16
37 0.16
38 0.16
39 0.19
40 0.19
41 0.19
42 0.18
43 0.16
44 0.15
45 0.13
46 0.11
47 0.09
48 0.09
49 0.13
50 0.14
51 0.14
52 0.17
53 0.23
54 0.23
55 0.28
56 0.35
57 0.4
58 0.42
59 0.52
60 0.6
61 0.64
62 0.7
63 0.74
64 0.76
65 0.76
66 0.82