Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397V861

Protein Details
Accession A0A397V861    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-27LEKRTGKSGTPRKVKKYLQQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011989  ARM-like  
IPR016024  ARM-type_fold  
IPR042462  ARMC7  
Amino Acid Sequences MFSTRRQLEKRTGKSGTPRKVKKYLQQLVTEYQDTKDQEAKYQVLANLVNFSYDPINYNWLWQLNVVDLFLDTLTESDEKLKEFGLGGLCNLCLEKRNKEHIINYDGIPLIIQCLYDKNEEIILSAITTLMFLLTDNEKNEDILSDSVKKRLEHLSQFENKRLKNLATIFLQDYFSKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.73
3 0.72
4 0.72
5 0.73
6 0.72
7 0.79
8 0.8
9 0.78
10 0.79
11 0.78
12 0.74
13 0.72
14 0.67
15 0.63
16 0.6
17 0.53
18 0.43
19 0.35
20 0.34
21 0.29
22 0.28
23 0.28
24 0.25
25 0.27
26 0.3
27 0.3
28 0.26
29 0.28
30 0.26
31 0.23
32 0.24
33 0.2
34 0.18
35 0.17
36 0.15
37 0.12
38 0.12
39 0.1
40 0.09
41 0.11
42 0.09
43 0.13
44 0.13
45 0.14
46 0.15
47 0.15
48 0.15
49 0.13
50 0.13
51 0.1
52 0.11
53 0.1
54 0.07
55 0.06
56 0.06
57 0.06
58 0.05
59 0.04
60 0.03
61 0.05
62 0.05
63 0.05
64 0.07
65 0.08
66 0.08
67 0.08
68 0.08
69 0.08
70 0.08
71 0.09
72 0.09
73 0.08
74 0.08
75 0.08
76 0.07
77 0.07
78 0.07
79 0.06
80 0.08
81 0.11
82 0.17
83 0.21
84 0.29
85 0.33
86 0.35
87 0.39
88 0.39
89 0.41
90 0.37
91 0.33
92 0.28
93 0.24
94 0.21
95 0.17
96 0.12
97 0.08
98 0.07
99 0.06
100 0.05
101 0.07
102 0.09
103 0.1
104 0.11
105 0.11
106 0.12
107 0.12
108 0.12
109 0.11
110 0.09
111 0.08
112 0.07
113 0.06
114 0.05
115 0.05
116 0.04
117 0.03
118 0.03
119 0.03
120 0.06
121 0.08
122 0.11
123 0.12
124 0.15
125 0.16
126 0.16
127 0.16
128 0.14
129 0.14
130 0.13
131 0.15
132 0.19
133 0.2
134 0.25
135 0.28
136 0.28
137 0.29
138 0.36
139 0.4
140 0.41
141 0.46
142 0.51
143 0.56
144 0.6
145 0.64
146 0.64
147 0.57
148 0.55
149 0.53
150 0.45
151 0.44
152 0.43
153 0.41
154 0.37
155 0.4
156 0.37
157 0.34
158 0.35