Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TZN7

Protein Details
Accession A0A397TZN7    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
21-42KSRGEIRKEKDRKQKAIQRADVBasic
69-89SNTAMLNRKKRRKLVFVLKETHydrophilic
NLS Segment(s)
PositionSequence
27-33RKEKDRK
78-79KR
Subcellular Location(s) mito 16, nucl 9.5, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MHIKKPNPMSLNMIYIMVIIKSRGEIRKEKDRKQKAIQRADVQFKEAENSKLQDRMMELRQNQAYVQASNTAMLNRKKRRKLVFVLKETMKQKLPTSLYVC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.22
3 0.19
4 0.12
5 0.1
6 0.07
7 0.06
8 0.08
9 0.13
10 0.17
11 0.22
12 0.29
13 0.35
14 0.46
15 0.54
16 0.61
17 0.67
18 0.72
19 0.75
20 0.78
21 0.81
22 0.79
23 0.81
24 0.78
25 0.74
26 0.7
27 0.7
28 0.6
29 0.53
30 0.44
31 0.34
32 0.3
33 0.25
34 0.21
35 0.15
36 0.16
37 0.15
38 0.17
39 0.16
40 0.15
41 0.14
42 0.17
43 0.19
44 0.22
45 0.22
46 0.25
47 0.26
48 0.26
49 0.24
50 0.24
51 0.22
52 0.17
53 0.17
54 0.14
55 0.14
56 0.14
57 0.14
58 0.12
59 0.17
60 0.23
61 0.33
62 0.4
63 0.5
64 0.57
65 0.66
66 0.72
67 0.74
68 0.78
69 0.8
70 0.8
71 0.78
72 0.78
73 0.72
74 0.71
75 0.65
76 0.6
77 0.53
78 0.46
79 0.42
80 0.43
81 0.44