Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397W3B7

Protein Details
Accession A0A397W3B7    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
28-50NGTLTFRRDKKKHKFSDRKTTYEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 15, cyto_nucl 12.5, nucl 8, mito 4
Family & Domain DBs
Amino Acid Sequences MVLEVRWDGTGIKNHESVITKFYGCNPNGTLTFRRDKKKHKFSDRKTTYELAIHEKKVPVERFLEFIGDLQTNMTFRFHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.3
3 0.33
4 0.29
5 0.25
6 0.23
7 0.21
8 0.2
9 0.25
10 0.29
11 0.26
12 0.28
13 0.26
14 0.27
15 0.28
16 0.31
17 0.28
18 0.25
19 0.33
20 0.36
21 0.43
22 0.46
23 0.55
24 0.62
25 0.7
26 0.75
27 0.78
28 0.83
29 0.83
30 0.88
31 0.84
32 0.78
33 0.71
34 0.63
35 0.53
36 0.46
37 0.39
38 0.36
39 0.34
40 0.31
41 0.29
42 0.29
43 0.3
44 0.34
45 0.34
46 0.29
47 0.28
48 0.28
49 0.27
50 0.27
51 0.26
52 0.18
53 0.17
54 0.17
55 0.14
56 0.13
57 0.12
58 0.13
59 0.12
60 0.13