Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397V7I3

Protein Details
Accession A0A397V7I3    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
91-117IQQEAKAKDKKEKKKNKSEQGKATLNDHydrophilic
NLS Segment(s)
PositionSequence
96-108KAKDKKEKKKNKS
Subcellular Location(s) nucl 17, mito_nucl 11.833, cyto_nucl 10.833, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006735  Rtf2  
Gene Ontology GO:0005634  C:nucleus  
GO:1902979  P:mitotic DNA replication termination  
Pfam View protein in Pfam  
PF04641  Rtf2  
Amino Acid Sequences MGDDGGSIPKRIELVKEKQKERLLKAPVVACTLGKLYKRDAVLEYLLNRSAELNGCVNGAQKTRLNLTPNTAFKKSSAKQTLKEVPSEACIQQEAKAKDKKEKKKNKSEQGKATLND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.44
3 0.53
4 0.54
5 0.61
6 0.67
7 0.68
8 0.66
9 0.65
10 0.6
11 0.55
12 0.56
13 0.52
14 0.46
15 0.41
16 0.35
17 0.26
18 0.22
19 0.2
20 0.19
21 0.18
22 0.18
23 0.18
24 0.21
25 0.22
26 0.23
27 0.22
28 0.21
29 0.2
30 0.21
31 0.2
32 0.17
33 0.18
34 0.16
35 0.15
36 0.12
37 0.12
38 0.1
39 0.1
40 0.09
41 0.08
42 0.08
43 0.09
44 0.09
45 0.1
46 0.1
47 0.11
48 0.11
49 0.12
50 0.15
51 0.18
52 0.2
53 0.19
54 0.23
55 0.28
56 0.31
57 0.35
58 0.34
59 0.31
60 0.29
61 0.38
62 0.35
63 0.38
64 0.43
65 0.42
66 0.44
67 0.52
68 0.59
69 0.52
70 0.51
71 0.43
72 0.35
73 0.34
74 0.34
75 0.26
76 0.18
77 0.17
78 0.16
79 0.19
80 0.26
81 0.27
82 0.31
83 0.37
84 0.39
85 0.48
86 0.57
87 0.64
88 0.67
89 0.75
90 0.78
91 0.84
92 0.92
93 0.93
94 0.94
95 0.93
96 0.92
97 0.9