Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UG12

Protein Details
Accession A0A397UG12    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
124-143HKIICFFKNKQKKTEKKTIEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 13, cyto 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011335  Restrct_endonuc-II-like  
IPR007560  Restrct_endonuc_IV_Mrr  
IPR011856  tRNA_endonuc-like_dom_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0004519  F:endonuclease activity  
GO:0009307  P:DNA restriction-modification system  
GO:0006302  P:double-strand break repair  
Pfam View protein in Pfam  
PF04471  Mrr_cat  
Amino Acid Sequences MEKKQPTVVIESNHTLGHDFENKLAKLLNENGLIANIISCNPGDYSVDIIASFNYQIILIQCKNVEKSIGSPELQKIESAFRRFGKEVLGIIVYNSEKLKNPLMKQANIWWKSCCPEIKIMNEHKIICFFKNKQKKTEKKTIEYLNPYADECSFGRFVIKGFRAEKCIVYSPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.25
3 0.21
4 0.22
5 0.23
6 0.21
7 0.23
8 0.3
9 0.29
10 0.29
11 0.3
12 0.25
13 0.24
14 0.27
15 0.28
16 0.22
17 0.22
18 0.21
19 0.2
20 0.2
21 0.15
22 0.11
23 0.07
24 0.06
25 0.06
26 0.06
27 0.07
28 0.07
29 0.08
30 0.08
31 0.09
32 0.11
33 0.11
34 0.11
35 0.1
36 0.1
37 0.09
38 0.09
39 0.08
40 0.05
41 0.05
42 0.05
43 0.05
44 0.06
45 0.11
46 0.1
47 0.12
48 0.13
49 0.14
50 0.15
51 0.15
52 0.15
53 0.11
54 0.13
55 0.17
56 0.19
57 0.18
58 0.18
59 0.19
60 0.21
61 0.21
62 0.19
63 0.14
64 0.17
65 0.21
66 0.22
67 0.24
68 0.23
69 0.26
70 0.27
71 0.26
72 0.23
73 0.19
74 0.17
75 0.15
76 0.14
77 0.1
78 0.09
79 0.11
80 0.08
81 0.08
82 0.08
83 0.08
84 0.09
85 0.11
86 0.17
87 0.2
88 0.21
89 0.29
90 0.34
91 0.34
92 0.34
93 0.4
94 0.44
95 0.42
96 0.42
97 0.35
98 0.32
99 0.33
100 0.36
101 0.3
102 0.23
103 0.28
104 0.31
105 0.35
106 0.41
107 0.44
108 0.46
109 0.47
110 0.46
111 0.39
112 0.41
113 0.37
114 0.31
115 0.34
116 0.33
117 0.4
118 0.5
119 0.53
120 0.57
121 0.66
122 0.74
123 0.75
124 0.81
125 0.8
126 0.76
127 0.8
128 0.78
129 0.76
130 0.73
131 0.67
132 0.6
133 0.52
134 0.47
135 0.39
136 0.31
137 0.25
138 0.19
139 0.2
140 0.17
141 0.16
142 0.17
143 0.16
144 0.17
145 0.23
146 0.25
147 0.28
148 0.31
149 0.34
150 0.38
151 0.4
152 0.41
153 0.37