Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TZN3

Protein Details
Accession A0A397TZN3    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
67-93SASRLQKKALNRSKRKRDKTSHSNISKHydrophilic
NLS Segment(s)
PositionSequence
73-85KKALNRSKRKRDK
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR045242  Syntaxin  
IPR000727  T_SNARE_dom  
Pfam View protein in Pfam  
PF05739  SNARE  
PROSITE View protein in PROSITE  
PS50192  T_SNARE  
CDD cd15840  SNARE_Qa  
Amino Acid Sequences MYEMMHMKIMKTGREIREIEQGLNELNEIFRDLGTLVSEQQSMLDNIESNVINISVNVRNSADELSSASRLQKKALNRSKRKRDKTSHSNISKNRVEVEAPTPIQLLLVPATTKRCILSVGKTNPTHPVLVVAQFAASEWVVPRIINTPTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.43
3 0.41
4 0.48
5 0.47
6 0.41
7 0.34
8 0.31
9 0.25
10 0.22
11 0.2
12 0.1
13 0.09
14 0.08
15 0.08
16 0.08
17 0.07
18 0.07
19 0.07
20 0.08
21 0.09
22 0.09
23 0.08
24 0.09
25 0.1
26 0.09
27 0.09
28 0.1
29 0.09
30 0.1
31 0.09
32 0.08
33 0.08
34 0.11
35 0.1
36 0.09
37 0.08
38 0.08
39 0.07
40 0.07
41 0.1
42 0.1
43 0.1
44 0.11
45 0.11
46 0.11
47 0.12
48 0.13
49 0.1
50 0.07
51 0.08
52 0.09
53 0.1
54 0.1
55 0.12
56 0.16
57 0.16
58 0.17
59 0.2
60 0.23
61 0.33
62 0.42
63 0.49
64 0.56
65 0.66
66 0.75
67 0.82
68 0.86
69 0.85
70 0.85
71 0.85
72 0.85
73 0.85
74 0.84
75 0.8
76 0.79
77 0.72
78 0.71
79 0.64
80 0.54
81 0.46
82 0.37
83 0.31
84 0.25
85 0.24
86 0.22
87 0.19
88 0.19
89 0.18
90 0.16
91 0.16
92 0.13
93 0.11
94 0.06
95 0.07
96 0.07
97 0.08
98 0.12
99 0.13
100 0.14
101 0.13
102 0.13
103 0.15
104 0.18
105 0.24
106 0.3
107 0.36
108 0.43
109 0.44
110 0.45
111 0.48
112 0.47
113 0.4
114 0.31
115 0.28
116 0.22
117 0.23
118 0.22
119 0.16
120 0.14
121 0.13
122 0.13
123 0.11
124 0.08
125 0.08
126 0.08
127 0.1
128 0.11
129 0.11
130 0.12
131 0.14