Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TTD2

Protein Details
Accession A0A397TTD2    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
3-23KVSTSGKKKGTQKYQNFYAFRHydrophilic
48-71NIIEWRKKFKRYKLLKTPKRCVCYHydrophilic
NLS Segment(s)
PositionSequence
55-57KFK
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR019351  DUF2039  
Pfam View protein in Pfam  
PF10217  DUF2039  
Amino Acid Sequences MIKVSTSGKKKGTQKYQNFYAFRANKNSKKTKLINLLPINSVYKRCKNIIEWRKKFKRYKLLKTPKRCVCYEEKTIKEAYHILCNKCAKDKGVCAKCQGSEDIVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.77
3 0.81
4 0.82
5 0.75
6 0.67
7 0.66
8 0.61
9 0.55
10 0.57
11 0.56
12 0.54
13 0.61
14 0.68
15 0.63
16 0.66
17 0.67
18 0.66
19 0.67
20 0.65
21 0.65
22 0.61
23 0.58
24 0.5
25 0.47
26 0.4
27 0.32
28 0.31
29 0.27
30 0.27
31 0.28
32 0.29
33 0.3
34 0.33
35 0.42
36 0.48
37 0.54
38 0.56
39 0.63
40 0.7
41 0.76
42 0.78
43 0.75
44 0.76
45 0.74
46 0.78
47 0.79
48 0.82
49 0.83
50 0.86
51 0.88
52 0.85
53 0.79
54 0.7
55 0.63
56 0.6
57 0.58
58 0.57
59 0.56
60 0.5
61 0.48
62 0.49
63 0.44
64 0.38
65 0.35
66 0.28
67 0.29
68 0.32
69 0.32
70 0.37
71 0.41
72 0.41
73 0.44
74 0.45
75 0.39
76 0.4
77 0.47
78 0.51
79 0.55
80 0.56
81 0.55
82 0.56
83 0.55
84 0.52
85 0.45