Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397VZ69

Protein Details
Accession A0A397VZ69    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
73-93DFWIFFLYYKKKEKRKKKNKRBasic
NLS Segment(s)
PositionSequence
82-93KKKEKRKKKNKR
Subcellular Location(s) mito 10, golg 6, plas 4, extr 3, nucl 1, pero 1, E.R. 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVLKSFFFFFTKNYNKKRIYIYFFLRSFFFWTTNINKKKNAKLSHPLLFFDFFFFCLFFFFVPNNNTRVFKNDFWIFFLYYKKKEKRKKKNKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.57
3 0.6
4 0.67
5 0.65
6 0.62
7 0.6
8 0.6
9 0.59
10 0.57
11 0.54
12 0.46
13 0.39
14 0.35
15 0.3
16 0.24
17 0.16
18 0.19
19 0.24
20 0.33
21 0.4
22 0.39
23 0.44
24 0.48
25 0.55
26 0.6
27 0.58
28 0.54
29 0.56
30 0.59
31 0.59
32 0.54
33 0.47
34 0.4
35 0.36
36 0.29
37 0.22
38 0.17
39 0.11
40 0.1
41 0.09
42 0.08
43 0.08
44 0.08
45 0.06
46 0.07
47 0.07
48 0.11
49 0.13
50 0.15
51 0.16
52 0.18
53 0.2
54 0.2
55 0.25
56 0.27
57 0.25
58 0.31
59 0.34
60 0.32
61 0.34
62 0.36
63 0.33
64 0.29
65 0.36
66 0.35
67 0.37
68 0.47
69 0.52
70 0.6
71 0.69
72 0.78
73 0.82