Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397VQI9

Protein Details
Accession A0A397VQI9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
58-77HTPIKPPVRRSKPSEDHRPCBasic
NLS Segment(s)
Subcellular Location(s) plas 10, extr 5, mito 3, cyto 3, cyto_mito 3, pero 2, E.R. 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MELRAYFILFIIFIVCSTASAVPAVHRNKHRGKPIPTVNHQEKMTHTPVKPPVNAPVHTPIKPPVRRSKPSEDHRPCYYRKRCYG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.08
5 0.08
6 0.07
7 0.08
8 0.08
9 0.09
10 0.16
11 0.2
12 0.25
13 0.29
14 0.36
15 0.44
16 0.51
17 0.58
18 0.6
19 0.62
20 0.65
21 0.7
22 0.7
23 0.67
24 0.69
25 0.64
26 0.6
27 0.55
28 0.46
29 0.39
30 0.37
31 0.36
32 0.33
33 0.29
34 0.3
35 0.37
36 0.4
37 0.39
38 0.35
39 0.39
40 0.38
41 0.39
42 0.36
43 0.37
44 0.38
45 0.37
46 0.38
47 0.36
48 0.41
49 0.45
50 0.49
51 0.51
52 0.56
53 0.62
54 0.68
55 0.72
56 0.72
57 0.77
58 0.82
59 0.8
60 0.77
61 0.79
62 0.77
63 0.72
64 0.73
65 0.73