Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397V6E9

Protein Details
Accession A0A397V6E9    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
9-34IKNKCDSTITNKKKKTRNLHLNLLLEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 14, cyto 4
Family & Domain DBs
Amino Acid Sequences MMNKCDSTIKNKCDSTITNKKKKTRNLHLNLLLELATFFFRKKKACILELAFRKSQDELEEHESLFQYYSKFYSNDLYLDESQDELQNELQQNESYQNEPCQDEPHQDESCPTESSPQAEPTCDKGSTNDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.51
3 0.53
4 0.57
5 0.59
6 0.66
7 0.73
8 0.76
9 0.82
10 0.83
11 0.82
12 0.83
13 0.81
14 0.83
15 0.82
16 0.76
17 0.66
18 0.56
19 0.44
20 0.33
21 0.25
22 0.16
23 0.09
24 0.07
25 0.08
26 0.1
27 0.14
28 0.16
29 0.19
30 0.26
31 0.3
32 0.31
33 0.37
34 0.38
35 0.43
36 0.47
37 0.48
38 0.42
39 0.37
40 0.36
41 0.3
42 0.27
43 0.2
44 0.16
45 0.15
46 0.19
47 0.2
48 0.19
49 0.19
50 0.18
51 0.16
52 0.15
53 0.12
54 0.07
55 0.07
56 0.08
57 0.09
58 0.09
59 0.1
60 0.12
61 0.12
62 0.13
63 0.13
64 0.16
65 0.15
66 0.15
67 0.14
68 0.12
69 0.12
70 0.13
71 0.12
72 0.1
73 0.1
74 0.13
75 0.13
76 0.13
77 0.14
78 0.12
79 0.13
80 0.15
81 0.16
82 0.14
83 0.15
84 0.17
85 0.19
86 0.2
87 0.2
88 0.21
89 0.21
90 0.25
91 0.29
92 0.32
93 0.3
94 0.29
95 0.3
96 0.3
97 0.31
98 0.27
99 0.22
100 0.21
101 0.22
102 0.25
103 0.27
104 0.3
105 0.28
106 0.29
107 0.32
108 0.33
109 0.36
110 0.33
111 0.31