Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UH44

Protein Details
Accession A0A397UH44    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
41-65NENIIKKLKNKDHKEKKHCNNVIKKBasic
NLS Segment(s)
Subcellular Location(s) nucl 10.5cyto_nucl 10.5, cyto 9.5, pero 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGYKGDNINIGNLNEILLAKEDSDSFKINIIEEGEDKNAANENIIKKLKNKDHKEKKHCNNVIKKDDYYRLFRTNFVFSWIFTNSLIIFLFTSNIFAKYFSTHDYNPYLIFGRLFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.11
4 0.1
5 0.1
6 0.08
7 0.09
8 0.1
9 0.12
10 0.14
11 0.16
12 0.14
13 0.17
14 0.18
15 0.17
16 0.18
17 0.16
18 0.15
19 0.14
20 0.16
21 0.13
22 0.13
23 0.13
24 0.12
25 0.12
26 0.11
27 0.11
28 0.13
29 0.13
30 0.2
31 0.22
32 0.23
33 0.25
34 0.33
35 0.41
36 0.47
37 0.54
38 0.58
39 0.68
40 0.78
41 0.84
42 0.86
43 0.86
44 0.87
45 0.84
46 0.81
47 0.8
48 0.78
49 0.75
50 0.68
51 0.61
52 0.54
53 0.54
54 0.49
55 0.45
56 0.41
57 0.4
58 0.37
59 0.38
60 0.37
61 0.34
62 0.31
63 0.3
64 0.26
65 0.2
66 0.22
67 0.21
68 0.19
69 0.16
70 0.17
71 0.12
72 0.12
73 0.12
74 0.09
75 0.08
76 0.07
77 0.08
78 0.07
79 0.1
80 0.1
81 0.11
82 0.11
83 0.11
84 0.12
85 0.14
86 0.16
87 0.17
88 0.21
89 0.21
90 0.25
91 0.28
92 0.29
93 0.27
94 0.27
95 0.26
96 0.21