Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LPV0

Protein Details
Accession E2LPV0    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MAHMCRKKLRRGYEWENCDTHydrophilic
134-155CDYKYRLKSVRKHLKKAHQIEEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 9.5, cyto 5.5, mito 4, pero 2, golg 2
Family & Domain DBs
KEGG mpr:MPER_08921  -  
Amino Acid Sequences MAHMCRKKLRRGYEWENCDTEWCSGTPSTHCEISLATDSMEMTKVICELYALDPKISLGAMMALDPLVECKSCIGRYGQKNTRVFERWTSVVIRCNGHKLVAVSPTDEAAVVAKESQLDKRWREIREWYRCKECDYKYRLKSVRKHLKKAHQIEENVDDHLEYTPHGNLLESARNKEVWILPPGRGQLEPDWPPLPYPAGWDPDSDSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.76
3 0.69
4 0.6
5 0.54
6 0.46
7 0.37
8 0.29
9 0.22
10 0.2
11 0.18
12 0.2
13 0.19
14 0.22
15 0.24
16 0.24
17 0.23
18 0.21
19 0.2
20 0.22
21 0.23
22 0.19
23 0.15
24 0.14
25 0.14
26 0.15
27 0.15
28 0.11
29 0.07
30 0.07
31 0.07
32 0.07
33 0.06
34 0.06
35 0.07
36 0.11
37 0.17
38 0.17
39 0.17
40 0.17
41 0.17
42 0.17
43 0.15
44 0.11
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.04
51 0.04
52 0.04
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.09
59 0.1
60 0.11
61 0.14
62 0.22
63 0.29
64 0.39
65 0.44
66 0.5
67 0.53
68 0.53
69 0.55
70 0.5
71 0.46
72 0.4
73 0.37
74 0.29
75 0.28
76 0.29
77 0.24
78 0.26
79 0.26
80 0.24
81 0.21
82 0.23
83 0.22
84 0.2
85 0.2
86 0.16
87 0.15
88 0.17
89 0.16
90 0.13
91 0.13
92 0.13
93 0.11
94 0.1
95 0.08
96 0.05
97 0.05
98 0.04
99 0.04
100 0.04
101 0.05
102 0.06
103 0.08
104 0.14
105 0.19
106 0.21
107 0.29
108 0.35
109 0.35
110 0.37
111 0.45
112 0.49
113 0.55
114 0.61
115 0.57
116 0.59
117 0.59
118 0.61
119 0.59
120 0.54
121 0.52
122 0.53
123 0.58
124 0.54
125 0.63
126 0.65
127 0.65
128 0.69
129 0.71
130 0.74
131 0.73
132 0.79
133 0.78
134 0.81
135 0.83
136 0.83
137 0.8
138 0.76
139 0.69
140 0.64
141 0.61
142 0.51
143 0.42
144 0.33
145 0.25
146 0.18
147 0.17
148 0.13
149 0.07
150 0.09
151 0.08
152 0.09
153 0.09
154 0.09
155 0.1
156 0.13
157 0.21
158 0.21
159 0.25
160 0.26
161 0.26
162 0.26
163 0.28
164 0.29
165 0.25
166 0.3
167 0.29
168 0.29
169 0.33
170 0.35
171 0.33
172 0.29
173 0.28
174 0.25
175 0.31
176 0.32
177 0.33
178 0.32
179 0.3
180 0.31
181 0.29
182 0.28
183 0.2
184 0.23
185 0.23
186 0.27
187 0.28
188 0.28