Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397UM94

Protein Details
Accession A0A397UM94    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
15-39LQYEKRTQVGRRKREEKRQNTSPISHydrophilic
NLS Segment(s)
PositionSequence
26-28RKR
Subcellular Location(s) nucl 18, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MSNQRYHAHFKKFVLQYEKRTQVGRRKREEKRQNTSPISLFGPSKEKIREKTGYLVTLSKRTHKSTKTTVCF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.58
3 0.58
4 0.62
5 0.65
6 0.57
7 0.57
8 0.56
9 0.57
10 0.61
11 0.62
12 0.63
13 0.66
14 0.73
15 0.8
16 0.84
17 0.84
18 0.83
19 0.82
20 0.8
21 0.73
22 0.68
23 0.57
24 0.49
25 0.4
26 0.32
27 0.24
28 0.17
29 0.19
30 0.17
31 0.2
32 0.24
33 0.28
34 0.3
35 0.37
36 0.39
37 0.37
38 0.43
39 0.43
40 0.39
41 0.36
42 0.37
43 0.33
44 0.38
45 0.37
46 0.38
47 0.4
48 0.44
49 0.51
50 0.51
51 0.57
52 0.6