Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UYV1

Protein Details
Accession A0A397UYV1    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-34PPPSVQKRKTTSIRNAKRKIKNQHDETYYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MNYEVPPPSVQKRKTTSIRNAKRKIKNQHDETYYSATSTLTSQANEHNSETSASTTSQLIGDPETLTQRLDLARQYVLNVIKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.69
3 0.71
4 0.73
5 0.8
6 0.82
7 0.85
8 0.86
9 0.87
10 0.88
11 0.88
12 0.87
13 0.87
14 0.83
15 0.81
16 0.75
17 0.68
18 0.61
19 0.56
20 0.44
21 0.34
22 0.27
23 0.19
24 0.16
25 0.14
26 0.13
27 0.09
28 0.09
29 0.09
30 0.12
31 0.15
32 0.16
33 0.16
34 0.14
35 0.13
36 0.14
37 0.14
38 0.12
39 0.11
40 0.1
41 0.1
42 0.1
43 0.1
44 0.09
45 0.09
46 0.09
47 0.08
48 0.09
49 0.08
50 0.09
51 0.11
52 0.12
53 0.11
54 0.11
55 0.12
56 0.12
57 0.14
58 0.15
59 0.15
60 0.17
61 0.17
62 0.18
63 0.22