Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397VSC0

Protein Details
Accession A0A397VSC0    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKYNRRSLTEPTKKQQRRTTEHydrophilic
56-100EPTNRKTTKLPTKKREEQPKDLNPPTKKQRTYLPKKYPPKKDEEKBasic
NLS Segment(s)
PositionSequence
53-104KKKEPTNRKTTKLPTKKREEQPKDLNPPTKKQRTYLPKKYPPKKDEEKPLKD
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MKYNRRSLTEPTKKQQRRTTEGLTEPTDEEKKTYQPKNDEKGLPKDLQNSLTKKKEPTNRKTTKLPTKKREEQPKDLNPPTKKQRTYLPKKYPPKKDEEKPLKDDEKTKSLSPKNVKSTTEKREETPKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.82
3 0.8
4 0.77
5 0.75
6 0.73
7 0.69
8 0.68
9 0.63
10 0.57
11 0.5
12 0.43
13 0.4
14 0.35
15 0.28
16 0.25
17 0.22
18 0.27
19 0.34
20 0.38
21 0.41
22 0.48
23 0.57
24 0.6
25 0.65
26 0.64
27 0.61
28 0.62
29 0.6
30 0.53
31 0.46
32 0.45
33 0.4
34 0.38
35 0.38
36 0.36
37 0.38
38 0.41
39 0.42
40 0.4
41 0.45
42 0.5
43 0.54
44 0.58
45 0.62
46 0.63
47 0.66
48 0.69
49 0.71
50 0.73
51 0.74
52 0.74
53 0.72
54 0.75
55 0.79
56 0.81
57 0.83
58 0.8
59 0.78
60 0.79
61 0.78
62 0.77
63 0.73
64 0.73
65 0.64
66 0.65
67 0.66
68 0.65
69 0.58
70 0.52
71 0.56
72 0.59
73 0.67
74 0.7
75 0.71
76 0.72
77 0.81
78 0.88
79 0.89
80 0.83
81 0.81
82 0.8
83 0.77
84 0.78
85 0.79
86 0.77
87 0.72
88 0.76
89 0.72
90 0.66
91 0.65
92 0.59
93 0.56
94 0.51
95 0.5
96 0.51
97 0.51
98 0.57
99 0.6
100 0.63
101 0.65
102 0.68
103 0.67
104 0.67
105 0.71
106 0.7
107 0.71
108 0.64
109 0.59