Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397V762

Protein Details
Accession A0A397V762    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
95-132HKLAEPEKTARKQRKERKNRAKKFRGTKKTKASTKKEKBasic
NLS Segment(s)
PositionSequence
87-132EPKYRLVRHKLAEPEKTARKQRKERKNRAKKFRGTKKTKASTKKEK
Subcellular Location(s) mito 15, nucl 6.5, cyto_nucl 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences ADAAGVTLRTRKFLTNRLLNRKQMVIDVIHPGLANLSKDDIREKLSKMYKADKETIFVFGFRTIFGGGRSTGFGLIYDDLPSAKKFEPKYRLVRHKLAEPEKTARKQRKERKNRAKKFRGTKKTKASTKKEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.5
3 0.6
4 0.67
5 0.73
6 0.72
7 0.7
8 0.64
9 0.55
10 0.47
11 0.4
12 0.31
13 0.26
14 0.25
15 0.22
16 0.2
17 0.18
18 0.16
19 0.14
20 0.14
21 0.12
22 0.09
23 0.11
24 0.11
25 0.12
26 0.14
27 0.15
28 0.17
29 0.2
30 0.21
31 0.27
32 0.31
33 0.35
34 0.36
35 0.43
36 0.44
37 0.45
38 0.49
39 0.41
40 0.38
41 0.35
42 0.35
43 0.27
44 0.22
45 0.18
46 0.14
47 0.13
48 0.11
49 0.11
50 0.07
51 0.08
52 0.08
53 0.08
54 0.07
55 0.07
56 0.08
57 0.07
58 0.07
59 0.07
60 0.06
61 0.06
62 0.07
63 0.07
64 0.07
65 0.07
66 0.07
67 0.08
68 0.08
69 0.1
70 0.11
71 0.16
72 0.19
73 0.27
74 0.34
75 0.4
76 0.5
77 0.57
78 0.66
79 0.67
80 0.71
81 0.66
82 0.66
83 0.68
84 0.65
85 0.6
86 0.55
87 0.56
88 0.57
89 0.62
90 0.65
91 0.65
92 0.69
93 0.74
94 0.8
95 0.83
96 0.86
97 0.9
98 0.92
99 0.94
100 0.94
101 0.95
102 0.95
103 0.94
104 0.93
105 0.93
106 0.93
107 0.91
108 0.9
109 0.9
110 0.9
111 0.9
112 0.89